KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_0898Help
Entry
SL1344_0898       CDS       T01724                                 

Gene name
ftsK
Definition
(GenBank) cell division protein FtsK
  KO
K03466  DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Brite
KEGG Orthology (KO) [BR:sey00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sey03036]
    SL1344_0898 (ftsK)
Chromosome and associated proteins [BR:sey03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    SL1344_0898 (ftsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsK_SpoIIIE FtsK_4TM FtsK_alpha FtsK_gamma AAA_10 DUF87 T2SSE TrwB_AAD_bind Adeno_IVa2 PP_M1
Motif
Other DBs
NCBI-ProteinID: CBW16994
UniProt: A0A0H3NA37
LinkDB All DBs
Position
993908..997993
Genome map
AA seq 1361 aa AA seqDB search
MSQEYTEDKDVTLTKLSSGRRLLEALLILIALFAVWLMAALLSFNPSDPSWSQTAWHEPI
HNLGGAPGAWLADTLFFIFGVMAYTIPVIIVGGCWFAWRHQSTDDYIDYFAVSLRLIGVL
ALILTSCGLAAINADDIWYFASGGVIGSLLSTTLQPLLHSSGGTIMLLCIWAAGLTLFTG
WSWVSIAEKLGGWLLNILTFASNRTRRDDTWVDDEEYDDEYDEETDGVQRESRRARILRG
ALARRKRLAEKFSNPRGRQTDAALFSGKRMDDDEDIQYSARGVAADPDDVLFSGNRATQP
EYDEYDPLLNGHSVTEPVAAAAAATAVTQTWAASADPIMQTPPMPGAEPVVAQPTVEWQP
VPGPQTGEPVIAPAPEGYQPHPQYAQPQEAQSAPWQQPVPVASAPQYAATPATAAEYDSL
APQETQPQWQPEPTHQPTPVYQPEPIAAEPSHMPPPVIEQPVATEPEPDTEETRPARPPL
YYFEEVEEKRAREREQLAAWYQPIPEPVKENVPVKPTVSVAPSIPPVEAVAAAASLDAGI
KSGALAAGAAAAAPAFSLATGGAPRPQVKEGIGPQLPRPNRVRVPTRRELASYGIKLPSQ
RIAEEKAREAERNQYETGAQLTDEEIDAMHQDELARQFAQSQQHRYGETYQHDTQQAEDD
DTAAEAELARQFAASQQQRYSGEQPAGAQPFSLDDLDFSPMKVLVDEGPHEPLFTPGVMP
ESTPVQQPVAPQPQPQYQQPQQPVAPQPQYQQPQQPVAPQPQYQQPQQPVAPQPQYQQPQ
QPVAPQPQYQQPQQPVAPQPQYQQPQQPVAPQPQYQQPQQPVAPQPQYQQPVAPQPQYQQ
PQQPTAPQDSLIHPLLMRNGDSRPLQRPTTPLPSLDLLTPPPSEVEPVDTFALEQMARLV
EARLADFRIKADVVNYSPGPVITRFELNLAPGVKAARISNLSRDLARSLSTVAVRVVEVI
PGKPYVGLELPNKKRQTVYLREVLDNAKFRENPSPLTVVLGKDIAGDPVVADLAKMPHLL
VAGTTGSGKSVGVNAMILSMLYKAQPEDVRFIMIDPKMLELSVYEGIPHLLTEVVTDMKD
AANALRWSVNEMERRYKLMSALGVRNLAGYNEKIAEAARMGRPIPDPYWKPGDSMDVQHP
VLEKLPYIVVLVDEFADLMMTVGKKVEELIARLAQKARAAGIHLVLATQRPSVDVITGLI
KANIPTRIAFTVSSKIDSRTILDQGGAESLLGMGDMLYSGPNSTMPVRVHGAFVRDQEVH
AVVQDWKARGRPQYVDGITSDSESEGGGGGFDGGEELDALFDQAVNFVTQKRKASISGVQ
RQFRIGYNRAARIIEQMEAQGIVSAQGHNGNREVLAPPPFE
NT seq 4086 nt NT seq  +upstreamnt  +downstreamnt
ttgagccaggaatatactgaagacaaagacgtcacattgacgaagttaagcagcgggcgc
cgacttttggaagcgttgttgatacttattgccctttttgccgtctggttgatggcggcc
ttgttgagctttaacccttcggaccccagttggtcgcaaaccgcctggcatgaacccatc
cataatttaggcggcgcgccgggcgcgtggctggccgatacactgttctttatttttggc
gtaatggcctacaccatccctgtcattattgtcggcgggtgttggtttgcgtggcgtcat
cagtctacggatgattacatcgactattttgctgtgtcgctacgccttatcggcgtgctg
gcgctgattctcacttcctgcggtctggcggccattaatgccgacgatatctggtatttc
gcctccggcggcgtaattggcagcctgttaagcaccacgctgcagccgttgttgcatagt
agcggcggaacgataatgcttctctgtatttgggctgccgggctgacgctctttaccggc
tggtcctgggtcagtatcgccgaaaaattaggcggctggctgcttaatatactgaccttc
gccagcaaccgtacccggcgtgatgatacgtgggttgacgacgaagagtatgatgacgaa
tacgatgaagaaaccgacggcgtgcagcgtgaatctcgccgggcgcgtattttgcgcggc
gcgttggcgcgtcgtaagcgactggctgaaaaattcagcaatccacggggccgtcagacc
gatgccgcgctcttttccggcaaacggatggatgatgacgaggacattcagtatagcgcg
cgcggcgtcgctgccgatcccgacgacgttctgttttcgggcaaccgtgcgacgcagccg
gaatatgatgaatatgatccgctgttaaacggccattctgtcaccgaaccggtcgccgcc
gctgcggctgcaactgccgtcacccagacgtgggcagcgtccgccgatcccataatgcaa
acgccgcccatgcctggggctgagccggttgtcgcgcaaccgaccgtggagtggcagccc
gtaccggggccgcaaaccggcgaaccggttatcgcgcctgcgccggaggggtatcagccg
catccgcaatatgctcaaccgcaggaggcgcaaagtgcgccgtggcagcaacctgtgcct
gtcgcttccgcgccgcaatacgccgcgacgccagcgaccgcagcagaatatgactctctt
gcgccgcaggaaacacagccgcaatggcagccggagccgacccatcagccgacgccggtt
tatcagccggagccgatagcggctgaaccttctcacatgccgccgccggttatcgaacag
ccggttgccaccgagcctgaacctgacacagaagagaccagacctgcccgtcctccgctt
tactattttgaagaggtggaagagaaacgcgcccgtgagcgcgaacaactggcggcatgg
tatcaaccgattccggagccggtaaaagagaacgtgccggtcaaacctacggtatctgtc
gcgccgtccataccgccagtggaagcggtagccgccgccgcgtcgcttgacgcaggtatt
aagagtggcgccctggcagcaggcgccgcggccgctgcgcctgcatttagtctggctacc
ggcggcgcgccgcgtccgcaggtgaaagaggggattggtccgcaactgccgcgtccgaac
cgcgttcgcgtgccgacccgacgggaactggcatcgtacggtattaagctgccgtcacag
aggattgcagaagaaaaagcccgcgaggcggagcgcaatcagtacgagacgggcgcgcag
ctaaccgatgaagaaatagatgcaatgcatcaggacgagttagcccgtcagtttgcgcag
tcgcagcagcatcgttatggtgagacgtatcagcatgatacgcaacaggcagaagatgac
gataccgctgcggaagctgaattagcccgccagtttgccgcttcgcaacagcagcgctat
tccggcgagcaacccgctggcgcgcagccgttctcactggacgatctggatttctcgcca
atgaaagtattggttgatgaaggtccgcacgaaccgctgttcacgccgggtgtcatgccc
gagtcaacgcctgttcagcaaccggtagcgccgcagcctcagccacagtaccagcagccg
caacagccggtagcgccgcaaccgcagtatcagcagccgcagcagccggtagcgccgcag
ccgcagtatcagcagccgcaacagccggtagcgcctcagccgcagtatcagcagccgcaa
cagccggtagcgccgcagccgcagtatcagcagccgcaacagccggtagcgccgcagccg
cagtatcagcagccgcagcagccggtagcgccgcagccacagtatcagcagccgcagcag
ccggtagcgccgcagccacagtatcagcagccggtagcgccgcagccacagtatcagcag
ccgcaacagccgacagcgccgcaagacagcttgatccacccgctgttgatgcgtaacggc
gacagccgtccattacagcgtccgacgacgccgctgccttcgttagatcttctgacaccg
ccgccgagcgaagttgaaccggtagatacctttgcgctggaacaaatggcgcgtctggtt
gaagcgcgtctggcggatttccgcattaaagctgatgtggtgaactattcgccaggcccg
gtcattactcgttttgaactgaatctggccccgggcgttaaagcagcgcgtatctccaac
ctttcccgggatctggcgcgctcattgtcaacggtagccgtacgcgttgtggaagtcatt
ccaggcaaaccttacgtagggttggaattgccgaacaagaaacggcaaaccgtttatctg
cgcgaagtgttggataacgccaaattccgcgagaatccgtcgccgcttaccgtggtgtta
ggtaaggatatcgcgggcgatccggtagtggcggatctggcgaaaatgcctcacctgctg
gtggccggtacgaccggttccggtaagtcggtcggggttaacgccatgatcctcagtatg
ctgtataaagcgcagccggaagacgttcgctttatcatgatcgacccgaaaatgttagaa
ctctcggtctatgaaggtataccgcatctgctgacggaagttgttaccgacatgaaagac
gcggctaacgcgttacgctggagcgtcaatgagatggagcgtcgctataagctgatgtcc
gcgctcggcgtgcgtaatctggctggttataacgagaaaatcgccgaagcggcccgcatg
ggacgtccgattccggacccgtactggaagccgggcgacagtatggatgttcagcatccg
gttctggaaaaactgccgtatatcgtggtactggttgatgaatttgccgacctgatgatg
accgttggtaaaaaagttgaagagctgatcgcgcgtctggcgcagaaagcgcgcgccgcg
gggattcacctggtactggcgacgcagcgtccgtcggtcgatgtgattactggtttaatt
aaagccaacattccaacccgtatcgcttttaccgtatccagcaagatcgactcccgcacc
attcttgatcagggtggcgctgagtcgctgctaggtatgggggacatgctctactccgga
ccaaactccaccatgccggtacgtgtccatggggcgtttgtgcgtgaccaggaagtccat
gcggtggttcaggactggaaagcgcgcggtcgtccgcaatatgtggatggcattacctcc
gacagcgaaagcgaaggtggcggtggcggttttgacggcggcgaagaattagatgcgcta
ttcgatcaggccgttaatttcgtcactcagaagcgaaaagcgtccatttccggcgttcag
cgtcagttccgcatcggctataaccgtgcggcgcgtattatcgaacagatggaagcgcag
ggtattgtcagcgctcaggggcataacggtaatcgtgaagtgctggctccgccgcctttt
gagtaa

DBGET integrated database retrieval system