KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_0983Help
Entry
SL1344_0983       CDS       T01724                                 

Gene name
sodCa
Definition
(GenBank) bacteriophage encoded superoxide dismutase [cu-zn] 1 precursor (ec 1.15.1.1) (sodCI)
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Brite
Enzymes [BR:sey01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SL1344_0983 (sodCa)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: CBW17079
UniProt: A0A0H3NF91
LinkDB All DBs
Structure
PDB: 

Position
complement(1086605..1087138)
Genome map
AA seq 177 aa AA seqDB search
MKYTILSLVAGALISCSAMAENTLTVKMNDALSSGTGENIGEITVSETPYGLLFTPHLNG
LTPGIHGFHVHTNPSCMPGMKDGKEVPALMAGGHLDPEKTGKHLGPYNDKGHLGDLPGLV
VNADGTATYPLLAPRLKSLSELKGHSLMIHKGGDNYSDKPAPLGGGGARFACGVIEK
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacacaatattgtcgctggtagctggtgcgctcatcagttgttcagcaatggca
gagaataccctgactgtaaagatgaacgatgccctgtccagcggaacaggagaaaacata
ggtgaaatcacagtttcagagacaccttacggtctgcttttcactcctcacctaaatggt
cttacgccaggaattcacggcttccatgtccacacaaacccaagttgtatgccgggaatg
aaagacggtaaagaggttccggcgctcatggccggaggacatcttgaccccgaaaaaacc
gggaaacatcttggcccatataatgacaaagggcatttgggggatctgcctggactggtt
gtcaatgcagatggtacagccacgtatccgttactggcaccacgccttaaatcactgtca
gaactgaaaggtcactcattgatgatccataaaggcggtgacaattactccgataaacct
gctccactgggtggtggcggtgcacgttttgcctgtggtgtcattgagaaataa

DBGET integrated database retrieval system