KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_1471Help
Entry
SL1344_1471       CDS       T01724                                 

Definition
(GenBank) hypothetical alcohol dehydrogenase
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C HI0933_like AlaDh_PNT_C TrkA_N Pyr_redox_2 DAO Peptidase_M55 Pyr_redox_3 Pyr_redox ADH_zinc_N_2 FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: CBW17566
UniProt: A0A0H3NBL8
LinkDB All DBs
Position
complement(1574173..1575198)
Genome map
AA seq 341 aa AA seqDB search
MKVKAVFINKPGEVETRWVDYPHKKENEVLIKVDAAGICGSDIGAFRGTNPLVTYPRIIG
HEVTGIVLQEGAGMPDNIKEGDRVIVDPYIYCGHCYPCSVGRTNCCENLNVIGVHVDGAM
QEVVTHPAHLIHKIPDNVPSEMAPLAEPLTIALHALHRANVKAGEYVAIIGAGAIGLMAA
LSARHYKATPILIDIVEERLRYAQKLGVPYVLNAADDQVIDAIKNITHGTMAQVVIEASG
ANSAIRNTLDLASFAGRISFTGWPKQETSLPTNLITYKELDLRGSRTSAGEFDEALRMLS
TLEINPQDVVSKVVNLDEIPDAVKELDRYPERYLKINAVFH
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcaaagctgtgttcattaataagcctggtgaagttgaaacccgctgggtggat
tatccccataagaaagaaaatgaagtattaattaaggttgatgctgcaggcatttgcgga
tcggatatcggggcttttcgtggaacgaacccactggttacttacccaagaattattggg
catgaagtgaccggaattgttcttcaggaaggcgccggaatgccggacaatattaaagaa
ggtgaccgcgtaattgttgacccctatatttattgtggtcactgctacccttgctctgtc
ggcagaactaattgttgtgaaaatttaaacgtcattggcgtgcatgtcgatggcgcaatg
caggaggtggttactcatcccgcacatttaattcataaaataccagataatgtgccttct
gaaatggcgccgctggcagaaccgctgaccatcgctctgcacgcgttgcatcgggcaaac
gttaaggccggggaatatgttgccatcatcggcgcgggggccattggtcttatggcggca
ttaagcgcgcgtcattacaaggcaacgcctattctgatcgatattgtggaagaaaggcta
cgctatgcgcaaaagcttggcgttccttatgtgctgaacgccgctgacgatcaggttatc
gacgctattaaaaatatcacccacggcaccatggcgcaggtcgtgatagaagcttccggc
gcaaatagcgctattcgaaatacgcttgatttagcatcgtttgctggtcgtatttcgttt
accggatggccaaaacaggaaacgtcgctgccgacgaacctgatcacctataaagaactg
gatttacgcggttcccgcaccagtgccggtgaatttgatgaggcattacgtatgctgtct
acgctggagattaatccgcaagatgtcgtcagtaaggtcgtcaatcttgatgagatccct
gatgcagttaaagaacttgatcgctatccggagcgctacttaaagattaatgctgttttc
cattga

DBGET integrated database retrieval system