KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_2775Help
Entry
SL1344_2775       CDS       T01724                                 

Gene name
gabD
Definition
(GenBank) succinate-semialdehyde dehydrogenase
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Pathway
sey00250  Alanine, aspartate and glutamate metabolism
sey00310  Lysine degradation
sey00350  Tyrosine metabolism
sey00650  Butanoate metabolism
sey00760  Nicotinate and nicotinamide metabolism
sey01100  Metabolic pathways
sey01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sey00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SL1344_2775 (gabD)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SL1344_2775 (gabD)
   00310 Lysine degradation
    SL1344_2775 (gabD)
   00350 Tyrosine metabolism
    SL1344_2775 (gabD)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SL1344_2775 (gabD)
Enzymes [BR:sey01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     SL1344_2775 (gabD)
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     SL1344_2775 (gabD)
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     SL1344_2775 (gabD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CBW18873
UniProt: A0A0H3NKZ8
LinkDB All DBs
Position
2962710..2964158
Genome map
AA seq 482 aa AA seqDB search
MQLNDSTLFRQQAFIDGDWRDARGGDVIPVSNPANGKPLGNVPKMGAEETRDAINAANRA
LPAWRALTAKERANILRRWFNLMMEHQDDLARLMTLEQGKPLAEAKGEISYAASFIEWFA
EEGKRIYGDTIPGHQADKRLLVIKQPIGVTAAITPWNFPSAMITRKAGPALAAGCTMVLK
PASQTPFSALALAELAQRAGIPAGVFNVVTGSAGDIGGELTSNPLVRKLSFTGSTEIGRQ
LMEQCAKDIKKVSLELGGNAPFIVFDDADLDKAVEGALASKFRNAGQTCVCANRLYVQDG
VYDRFAEKLNQAVNKLAVGDGLQADVAIGPLIDEKAVAKVQEHIADALEKGARVITGGEA
HKLGGNFFQPTILADVPDNAKVAKEETFGPLAPLFRFSDEADVIRQANDTEFGLAAYFYA
RDLSRVFRVGEALEYGIVGINTGIISNEVAPFGGIKASGLGREGSKYGIEDYLEIKYMCI
GL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcaacttaacgactctaccctgttccgccagcaggcctttatcgatggcgactggcgc
gacgcgcgcggcggcgatgtcatccccgtgagcaaccccgccaacgggaaaccgcttggc
aatgtgcccaaaatgggggcggaagagacgcgcgacgccatcaacgccgccaatcgcgcc
ctgcccgcctggcgcgcgctcaccgccaaagagcgagccaatatcctgcgtcgctggttc
aatctgatgatggaacatcaggacgatttggcgcgtctgatgacgctggaacagggtaaa
ccgctggcggaagcgaaaggcgaaattagctacgccgcctcgtttattgaatggttcgcc
gaagaggggaagcgtatctatggcgacacgattccaggccatcaggccgataaacggctg
ctggtgattaaacagcccatcggcgtcaccgccgcgattaccccgtggaactttccctcg
gcaatgatcacccgtaaagccggccccgcgctggccgcaggctgcacaatggtactcaaa
cccgccagccagacgccgttttccgcgctggcgctggcggaactggcccagcgcgccgga
attcccgcaggcgtatttaacgtcgttaccggttcggcaggcgatatcggcggcgagctg
accagcaacccgctggtacgcaaactgtcgtttaccggctcgacggagattggccgccag
ctaatggaacaatgcgccaaagacattaaaaaagtgtcgctggaattgggcggcaatgcg
ccgtttatcgtctttgacgatgccgatctggataaagccgtcgaaggcgcgctggcttcg
aagtttcgcaacgccgggcagacctgtgtctgcgccaatagattgtatgttcaggacggc
gtttacgatcgttttgcggaaaaactcaaccaggcggtaaataagctcgcggtcggtgac
ggcctgcaagccgacgtcgctatcgggccgctgattgatgaaaaagccgtggcgaaagtc
caggaacatatcgccgatgcgctggaaaaaggcgcccgcgtcattacgggcggtgaagcg
cacaaattgggcggcaacttctttcaaccgaccattctggcggatgttcctgataacgcg
aaagtcgccaaagaagagacattcgggccgctcgcgcctctgttccgcttcagcgacgag
gcggacgtcatcaggcaggctaacgataccgagttcggcctggcagcctatttttatgca
cgcgatttaagccgcgttttccgcgtcggcgaagcgctggaatacggcatcgtcggtatt
aataccggcattatctccaacgaagtcgcgcctttcggcggcattaaggcctccggatta
ggccgagaaggttccaaatacggcatcgaagattatttagaaatcaaatatatgtgcatc
ggcctttaa

DBGET integrated database retrieval system