KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_3821Help
Entry
SL1344_3821       CDS       T01724                                 

Gene name
pstB
Definition
(GenBank) phosphate transport ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Pathway
sey02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sey00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SL1344_3821 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sey02000]
    SL1344_3821 (pstB)
Enzymes [BR:sey01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     SL1344_3821 (pstB)
Transporters [BR:sey02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    SL1344_3821 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 AAA_22 RsgA_GTPase AAA_16 Rad17 AAA_23 AAA_30 G-alpha AAA_33 TniB PRK AAA_25 Adeno_IVa2 PhoH AAA_24 Mg_chelatase AAA_28 AAA_5 ATPase_2 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: CBW19912
UniProt: A0A0H3NU57
LinkDB All DBs
Position
complement(4082051..4082824)
Genome map
AA seq 257 aa AA seqDB search
MSMVETAPSKIQVRDLNFYYGKFHALKNINLDIAKNQVTAFIGPSGCGKSTLLRTFNKMY
SLYPEQRAEGEILLDGDNILTNTQDIALLRAKVGMVFQKPTPFPMSIYDNIAFGVRLFEK
LSRADMDERVQWALTKAALWNETKDKLHQSGYSLSGGQQQRLCIARGIAIRPEVLLLDEP
CSALDPISTGRIEELITELKQDYTVVIVTHNMQQAARCSDHTAFMYLGELIEFSNTDDLF
TKPAKKQTEDYITGRYG
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagtatggttgaaactgccccgagtaagattcaggttcgtgatttgaacttctactac
ggcaaattccatgccctgaagaacattaatctggatatcgcgaagaatcaggtaacggca
tttatcgggccatccggctgcggtaaatcaacgctactgcgtaccttcaataaaatgtat
tcgctttatccggagcagcgcgcggaaggtgaaattctgctggatggcgacaatattctc
accaacacccaggatatcgcgctgctgcgcgcaaaagtggggatggtattccagaagccg
acgccgttcccgatgtccatctatgacaatatcgcctttggcgtgcgtctgtttgagaag
ctgtctcgcgccgatatggacgagcgcgtgcagtgggcgttgaccaaagccgcattatgg
aacgaaaccaaagataaattgcaccagagcgggtactctctctccggtggtcagcagcag
cgtctgtgcattgcgcgcggtatcgccattcgcccggaagtgctgctgctggatgagcca
tgttcagctctggacccgatctctaccgggcgtattgaagagctgatcaccgagctgaaa
caggattacaccgtggtgatcgtgacccacaacatgcagcaggcggcacgttgctccgat
catacggcgtttatgtacctgggcgagttgattgagttcagcaacacggacgatctgttc
accaagcccgcgaagaaacaaacagaagactatatcaccggtcgttacggttaa

DBGET integrated database retrieval system