KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_0390Help
Entry
Sez_0390          CDS       T00746                                 

Gene name
gatA
Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase subunit A GatC
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
sez00970  Aminoacyl-tRNA biosynthesis
sez01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sez00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Sez_0390 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sez03029]
    Sez_0390 (gatA)
Enzymes [BR:sez01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Sez_0390 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Sez_0390 (gatA)
Mitochondrial biogenesis [BR:sez03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Sez_0390 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ACG61764
UniProt: B4U197
LinkDB All DBs
Position
418183..419649
Genome map
AA seq 488 aa AA seqDB search
MSFNHHTIEELHELLVAKDISAVELTKATLEDIKAREEAVGSFITIAEEAALKQAAALDA
KGIDPDNVMSGIPLAVKDNISTKGILTTAASKMLYNYEPIFDATAVANAYDKDMIIIGKT
NMDEFAMGGSTETSYFKKTKNAWDRSRVPGGSSGGSATAVASGQVRLSLGSDTGGSIRQP
AAFNGVVGLKPTYGAVSRYGLIAFGSSLDQIGPFAPTVRENAQLLTVIAGSDRKDSTSAP
VQIADYTSKIGQDIKGMKIALPKEYLGEGIDPKIKETVLAAAKHFEKLGAIIEEVSLPHS
KYGVAVYYIIASSEASSNLQRFDGIRYGFRAADAKSLEDIYVKTRSQGFGDEVKRRIMLG
TFSLSSGYYDAYFKKAGQVRTLIIQDFEKVFADYDLILGPTAPTAAFELDTLNHDPVAMY
LADLLTIPVNLAGLPAISIPAGFADGLPVGLQLIGPKYSEEVIYQAAAAFEATTDYHKQQ
PMIFGGDS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttaatcatcacactatagaagaattacatgagcttcttgttgcaaaggacatt
tctgcagttgagctaacaaaggcaacccttgaggatatcaaggcgcgtgaagaggctgtg
ggttctttcattaccattgctgaggaggcagccttgaagcaggctgcggcacttgatgcc
aaggggattgatcctgacaatgtgatgtcaggaataccactagctgtcaaggacaatatc
tcaaccaagggaatcctgacaactgctgcctctaagatgctttataattatgagccgatt
tttgatgcgacagcagtagctaatgcctatgataaggatatgattatcatcggtaagacc
aacatggacgagtttgctatgggtggctcaacagaaacgtcttatttcaagaaaaccaaa
aacgcttgggatcgtagcagggttcctggtggttcatcaggtggctctgcaacagcagta
gcttcaggtcaggttcgcttatcccttggctcagatactggaggctctattcgtcagcca
gcagcctttaatggtgttgtcgggctgaagccaacctacggggctgtttctcgctatggc
ttgattgcctttggcagctcgctggatcagatagggccttttgcgccaacggtcagagaa
aatgctcagctgctgactgtcatagcagggagtgatcgtaaggactcaacctctgcacct
gtgcagattgctgactataccagtaaaattggccaagatatcaagggcatgaaaattgca
ctacctaaagaatatctaggcgaaggcattgatcctaagattaaagagacggttttagct
gctgctaagcattttgagaagctgggagctatcattgaggaggtcagtctgccacatagc
aagtatggggtggctgtctattatatcattgcttcatctgaggcctcgtcaaacctacag
cgatttgatggtattcgctatggctttcgtgctgctgatgccaagagccttgaggacatc
tatgttaagacgcgtagtcagggctttggtgatgaggttaagcgtcgtatcatgcttggt
acctttagcttatcgtcaggctattacgatgcttatttcaaaaaggcaggtcaggttcgg
acgctgatcattcaagattttgagaaggtttttgctgattatgacttgattttaggacca
acagcaccaacagcagcctttgagcttgatacgttgaatcatgatcctgttgccatgtat
ttggctgatcttttgaccattccggtgaatctagcgggcttgcctgcgatctctattcca
gcaggctttgcagatggcttacctgttgggcttcaattgatcggtccaaaatatagtgaa
gaggtcatctatcaggcagcagcagcctttgaagcgactactgactaccacaagcagcag
cctatgatttttggaggtgacagctaa

DBGET integrated database retrieval system