KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_1220Help
Entry
Sez_1220          CDS       T00746                                 

Gene name
acoC
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system AcoC
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
sez00010  Glycolysis / Gluconeogenesis
sez00020  Citrate cycle (TCA cycle)
sez00620  Pyruvate metabolism
sez01100  Metabolic pathways
sez01110  Biosynthesis of secondary metabolites
sez01120  Microbial metabolism in diverse environments
sez01130  Biosynthesis of antibiotics
sez01200  Carbon metabolism
Module
sez_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sez00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sez_1220 (acoC)
   00020 Citrate cycle (TCA cycle)
    Sez_1220 (acoC)
   00620 Pyruvate metabolism
    Sez_1220 (acoC)
Enzymes [BR:sez01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Sez_1220 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ACG62560
UniProt: B4U3J3
LinkDB All DBs
Position
complement(1251590..1252996)
Genome map
AA seq 468 aa AA seqDB search
MAVEIIMPKLGVDMQEGEIIEWKKQEGDTVSEGDILLEIMSDKTNMELEAEDSGVLLKVT
RQAGETVPVTEVIGYIGAAGESVDGSASSKKATEPPVPTTSSANAVTASKEAASTAPQVA
SAANVPAFGEKVRATPAARKAASEMGIELNQVPGTGPKGRIHKEDVEGFKGAQPKATPLA
RKIAADKGIDLAAVVGTGIGGKITKEDILAVLGAAAPAVEKASIAEEKPAKELPEGVEVK
KMSAMRKAISKGMTHSYLTAPTFTLNYDIDMTEMIALRKKLIDPIMAKTGLKVSFTDLIG
LAVVKTLMKPEHEYMNASLINDANDIELHRFVNLGIAVGLDDGLVVPVVHGADKMSLSEF
VLASKDVIKKAQGGKLKAAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGIGATIPTP
TVVDGEIVARPIMAMCLTIDHRLVDGMNGAKFMVDLKKLMENPFELLI
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcgaaattattatgccaaagctcggtgttgacatgcaagaaggcgagatcatc
gagtggaaaaagcaggagggtgacactgtcagcgagggtgacattcttcttgaaatcatg
tcagacaagacaaatatggagcttgaagcagaggattcaggtgtgcttctaaaagtcact
cgccaggcaggtgaaacagtccctgtcactgaggttatcggctatattggtgctgcgggt
gaatctgttgatggctctgcttcaagtaaaaaagcaactgaacccccagtaccaacaaca
tcatcagctaatgcagtaactgcctcaaaagaagcagcttcaacagcgcctcaggtagca
tcagctgccaatgttccagctttcggagaaaaggttcgcgcaacgccagcagctcgtaaa
gcagcttcagaaatgggaattgagcttaaccaagtgccaggaacaggaccaaaaggccgt
atccacaaagaagacgttgaaggtttcaagggagctcagcctaaggcgacaccgcttgct
cgcaagatagctgccgacaagggcattgaccttgcagcggttgtcggaacaggtattggt
ggcaagattaccaaggaggatattttggctgtgcttggcgcagcggcacctgctgtggaa
aaagcatctattgctgaagaaaagcctgctaaggagcttccagagggtgttgaagttaag
aagatgtctgctatgcgtaaggctatttcaaagggtatgacacattcctaccttacagca
ccaacctttacgcttaattatgacattgacatgaccgaaatgattgccttgcgtaagaag
ctgattgacccaatcatggctaaaacagggctaaaggtcagctttactgatttgattggt
ttagcagttgtcaaaacattgatgaagccagagcacgaatacatgaatgcgtcattgatt
aatgatgctaatgatattgagcttcatcgctttgtcaaccttggtattgctgtaggactt
gatgatgggctagttgtgccggttgttcatggtgcagataagatgagtctctcagagttt
gtccttgcttctaaggacgttatcaaaaaggctcaaggaggcaagctaaaggctgccgaa
atgtcaggctcaaccttctccatcacaaatctgggtatgtttggcaccaaaaccttcaat
ccaattatcaatcagcctaattcagctattctaggtattggggcaaccattccaacccca
acagtggtcgatggtgagattgttgcacgtccaatcatggcaatgtgtctgacaattgat
caccgcctggtggacggcatgaatggtgctaaatttatggttgatctcaaaaaattgatg
gaaaatccatttgaactgctaatctga

DBGET integrated database retrieval system