KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_1409Help
Entry
Sez_1409          CDS       T00746                                 

Gene name
amyS
Definition
(GenBank) cytoplasmic alpha-amylase AmyS
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
sez00500  Starch and sucrose metabolism
sez01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sez00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sez_1409 (amyS)
Enzymes [BR:sez01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Sez_1409 (amyS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: ACG62745
UniProt: B4U428
LinkDB All DBs
Position
complement(1448314..1449771)
Genome map
AA seq 485 aa AA seqDB search
MQAFEWYLPADAKHWQRLKSSIPELQQLGVSQLWLPPAFKGTSSDDVGYGVYDLFDLGEF
DQNGTVSTKYGSKEDYLQLIAALKEAKIKPIADVVLNHKANGDHKERFSVIKMNPENRQQ
PLTEPYEIEGWTGFDFPGRQNTYNDFKWHWYHFTGLDYDARSNEIGIYMITGDNKGWAND
ELIDDEHGNFDYLMYNDLDFKHPEVIQNLQDWAKWFIETTGIEGFRLDAVKHIDSYFIQT
FINDIRTQLKPDLEVFGEYWKSDQESMEDYLEATKAQFALVDVALHMSFFNASQQGADFD
LTTIFDGSLVASRPDLAITFVENHDTQRGQALESTVEEWFKPLAYGLILLRQEGKPCLFY
GDYYGISGNYPQQSFKGVITKMAELRQELVYGEQVDYFDHANCIGWTCLGDDQRPQPLAV
VLSNGDAGWKHMEVGQAYAGQVFCDFLDNCQETVVVDEDGWADFKVEAGSVSAWVLQKAQ
PKEEA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcctttgaatggtatttacctgctgatgcaaagcattggcaaaggctgaaaagc
agtattcctgagctgcagcagctaggtgttagtcagctgtggctgccgcctgcctttaag
ggcactagctctgacgatgtgggatacggtgtttacgatttgtttgatttgggagagttt
gaccaaaatgggactgtcagcacaaaatatggcagcaaagaggattatttgcagctgatt
gcagccctaaaagaggcaaaaataaagcctattgctgatgttgtgctgaaccataaggct
aatggtgatcacaaggaacgcttttctgtgatcaaaatgaatccagagaaccgtcagcag
cctctcacagagccctatgagattgaaggctggacaggctttgattttcccggcagacaa
aatacctataatgactttaaatggcactggtatcattttacgggattggattatgacgcc
aggtctaacgagataggtatttacatgatcaccggtgataacaagggctgggccaatgat
gagcttattgatgatgagcatggtaattttgattatctaatgtacaatgacctggatttc
aagcaccctgaggtaatccaaaatttacaggattgggccaagtggtttattgagacaact
ggtattgagggctttcgcttagacgctgtgaagcatattgattcttattttattcagacc
tttatcaatgatattcgtacccagctaaagcctgatttagaggtttttggagaatactgg
aagtctgatcaggaatctatggaggattacctcgaagcaacgaaggctcagtttgctctg
gttgatgttgcgctgcatatgtccttttttaatgctagccagcaaggagctgattttgat
ttgaccactatctttgatggcagtcttgtggctagtcggccggaccttgctattaccttt
gtggaaaaccatgacacccaaagagggcaagccttagagtcaactgttgaggaatggttc
aagcccttggcctatggcctgattcttttgcggcaagagggcaagccctgtcttttttat
ggtgattattatggtatttctggaaactaccctcagcaaagctttaagggggttatcaca
aaaatggcagagctcaggcaggagctggtctatggggagcaggttgattactttgatcat
gccaattgtatcggctggacctgcttaggagatgatcagcgtcctcagcctttggcagtt
gttttgtctaatggcgatgcaggctggaagcacatggaggttggtcaagcctatgctggt
caagttttttgtgatttcttagacaattgtcaggagactgttgttgttgatgaggatggc
tgggcagatttcaaggtagaggcaggttctgtctcagcctgggtgttacaaaaagcacag
ccaaaagaagaagcttaa

DBGET integrated database retrieval system