KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_1425Help
Entry
Sez_1425          CDS       T00746                                 

Gene name
nanA
Definition
(GenBank) sialidase NanA-like
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
sez00511  Other glycan degradation
sez00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sez00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Sez_1425 (nanA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Sez_1425 (nanA)
Enzymes [BR:sez01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Sez_1425 (nanA)
Bacterial toxins [BR:sez02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Sez_1425 (nanA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_16 BNR_2 BNR_3 YSIRK_signal Sialidase Laminin_G_3 BNR
Motif
Other DBs
NCBI-ProteinID: ACG62759
UniProt: B4U442
LinkDB All DBs
Position
complement(1463854..1468494)
Genome map
AA seq 1546 aa AA seqDB search
MFFNRSGQEQVRRYAIKKLSVGVASVCVGIGLAVCLPVAVFAEDMSEASPQPPTKAAVTE
ISHEQEPQATDTDSEALVVSEETTVDEAVVANAVTSNAADQTADEEKSNAPVELNKVANG
GFDNDYVSNKNQWQYREGGHSVLTTENNNSYAEVTSGTLDEHILQKVSTTVGKTYTLEAD
VKVEAATPHNGLYLTAKESNHNLQGPVIKEVSLTDTDGTWSHIKLSFTATTSETFIGLVK
WLEASSPEALAASASIDNVSVVEENDYELIWEDEFSGDRLNQENWGYELGSIRGNEQQHY
TDSTENVYLENGNLVLNVTERKGEDRYANPRGGTSARQVIYDSGSVRTVGKQEFLYGRIE
ARAKLPKGKGAFPAFWTLGADFTLDGDIASTQGYGWPSTGELDIMELIGAPNGEHEGELA
EGDQSNKTVYGTPHFYYVKGDADKDGSYSPTALGGNLTLSDDFYDDYHIFGINWYPDKIE
WYVDGIVYNTMYLTGDERLEAAAAAFNKPQYLQFNLATGGNWSKNAGYYLASDETAFVID
YVRYYQDAEQKAASEAYYASQPDLKGVKDLTMLEGTSPDLAQEVTTDQEGYVVDFSIENE
YLFTNKGGNTNATLQASGRNDLAALSELAPGIYNIYYSAVPEAANLGSTVTPTAKIAREV
AILTVLPKEGLYGQKGEPLSTVALPTNWQWVTPEEILGSAEHYQIKYTTEGGRAVYTTIE
ASYIADQPSSDEQSILVDLGNAILDATAEKAAVTDDEVLSKLDDVMSLNQGTVTIRYRLD
TADTTVRSAAPLALLSISNQASAKEYASFFIEPKNNKIGLEFKGAEVPIVKVGSGFNLLT
NSDWQTISYVFTGSRLKIYLNGDLYGEADFAGFMKQLPWKASADTVTVGGLSRSYDGESA
FHWGLKGLVDQVLIDTDVYDLTDIAKAHQSTLRQVTGEKLNVWDKYDEGVFEYRIPSVVK
TPSGTLIAAADARKKHYNDWGDIATVVRISHDDGKTWSNNITVLDMPTQPYFTTQYSLAD
WNTNMTQSACSIDSTLLTDASGKLYLLVDVFPESQGAVASKAGSGYEWINGQYYLNLYDF
DNHKYTVREEGIVYDSNGKKTDMYVDEGNFETAFSTRGNLYQTGAGEDILLGNIYLRSGR
TKQGITREGSQTAPLFTYMTSFLWLLTSEDEGQTWSTPLDVTPQIKEDWMGFLGTGAAAG
IEIDAVNAEGEQVKRLVFPIYYTNQQNATSASLGRQSSANIFSDDGGQTWQRGESPNDGR
IYGHNQQTTSKDFDTSVTELTENQIIQLNNGHLLQFMRNTGKTIVIARSTDYGATWDDNP
TITDLPEPYVNLSAIHMMVDGKEYVVLSNPLGEPSGEQLTIRNQRMKGILRVGEVLEDDS
IDWVASTIFEPKRFAYSSLVQLDDERVGLLYEYSGQITYSTFNIKQMISDQFREDKAEIE
EVTITSAAPKQSGKASITIQMTFNQPMFILGDRQLAVTVNGVDKLASYVSGDGTDTAIFE
LSLESMPEGPITVLPQFDHTIVETKYGIRLTDDKTYTLSYPDPATA
NT seq 4641 nt NT seq  +upstreamnt  +downstreamnt
atgttttttaatcgtagtggtcaagagcaagtcagaagatatgctatcaaaaagcttagt
gttggtgttgcttcagtatgtgtcggcattggtcttgctgtctgtctgccggtagctgtt
tttgccgaggatatgtcagaggcaagcccgcagccgcctacgaaagcagcagtaacagag
ataagccatgagcaggagcctcaagctacagatacagatagcgaggccttagtagtctca
gaggagacgacagtagatgaggcagtagtagctaatgctgtgaccagcaatgctgctgat
cagacagcagacgaagagaagtctaacgctcctgttgagctcaacaaggtggctaatggt
ggttttgataatgattatgtgtccaataagaatcagtggcaatatagagagggaggtcat
tcagtccttacaacagagaataataatagctatgctgaggtaacaagcggcactttagat
gagcatatcctccaaaaggtgtctacaacggttgggaaaacctatacgctagaggctgat
gtgaaggttgaagctgctacgcctcataatggcttataccttaccgctaaagagtccaat
cacaatcttcagggccctgttatcaaagaggtcagcctcacagatacagacggtacttgg
tcacatatcaagctctcctttacagcaacgacttcagaaacctttatcggcttagtcaaa
tggttggaagcctcttctccggaagccttggctgcctctgctagtattgataacgtgagt
gtcgtagaggaaaatgattatgaattgatttgggaggatgagttttcaggagatcggtta
aaccaagagaactggggatatgaattgggaagtattcgcgggaatgaacagcagcactac
acagacagcacagagaatgtttatcttgaaaatggtaatcttgttttaaacgtcacagag
cgtaagggtgaggaccgttatgccaatcctagaggaggaacaagcgcacgtcaggtcatt
tatgattcaggaagcgtacgaacggttggcaagcaagaatttttatatggtcgtatcgaa
gctagggccaagcttcccaagggtaagggagcctttccagccttttggacattgggggct
gattttaccttagatggtgatattgcgtcaactcaaggctatggctggccaagcacaggt
gagcttgacattatggagctaatcggtgctcctaacggagagcatgagggtgagcttgcc
gaaggtgatcaaagcaacaaaacagtttacgggacccctcatttttactacgtcaaaggt
gatgcagataaggacggcagctatagtccaactgcattgggtggcaatctgacattaagt
gatgacttttatgatgactaccatatctttggtattaactggtatccagataagattgaa
tggtatgttgatgggattgtttacaacaccatgtatttaacaggtgatgaacgcttagag
gcggcagcagctgcttttaacaagccacaatatctccaattcaaccttgcgactggagga
aactggagcaaaaatgcagggtactatctagcttcagatgagacagcctttgtgattgac
tatgtgcgttattaccaagacgctgagcaaaaggctgcttcagaagcctactatgcctca
cagccagacctcaagggggttaaggacttaacgatgctagaaggcaccagtcctgatttg
gcacaagaggtgaccactgatcaggaaggctatgtggttgatttttcaattgaaaatgag
tacttgtttaccaacaaaggtgggaataccaatgccaccttgcaggcttctggacgaaat
gacttagcagctttatctgaattagctcctggtatttataatatttactatagtgcagtt
cctgaggctgctaatctaggatcaacagtgaccccaacagcaaaaattgcaagagaagtg
gctattctaacagtattgccaaaggaagggctatatggtcaaaaaggagagcccttgtct
acagttgccctaccaaccaattggcaatgggttacgccagaggagatcttgggaagtgca
gagcattatcagatcaaatacaccacagaaggtggaagagctgtttatacaacgatagag
gcaagctatatcgcagatcagccaagctctgatgaacaatctattttagttgatttaggc
aatgctattttggacgcaacggcagaaaaagcagccgtaacagatgacgaggttcttagc
aagctagacgatgtgatgagcttaaatcaaggaacagtaacaatcaggtaccgcctagat
actgctgatacaaccgtaaggagtgcagcgcctttagccctgttatcgatctcaaatcaa
gcatcagctaaggaatacgcttctttctttattgagcctaaaaataacaaaataggtctt
gaatttaagggtgctgaggtgccgattgtaaaagttggctcaggctttaacctactaact
aactcagactggcagacgatcagctatgtctttacagggtctaggctaaagatttacttg
aatggtgacttatatggggaagctgactttgctgggtttatgaagcaattgccttggaag
gcttctgctgatacagtaacggttggaggattaagccgatcttatgatggcgaatcagcc
ttccattgggggttaaagggactggttgatcaggtgctgattgatacagatgtgtatgat
ctgacagatattgctaaggcacaccagtcaacccttcggcaggtgacaggtgagaagctc
aatgtttgggacaaatatgatgaaggcgtctttgaatatcggattccctctgttgtcaaa
acgccatcaggaaccttgatagctgcagcagatgcaagaaagaagcactacaatgactgg
ggagacattgcaactgttgtcaggataagccatgatgatggcaaaacctggagtaataac
attacggtcttagatatgccaactcagccttattttacaacacagtatagcttggctgat
tggaataccaatatgactcaatcagcctgttcgattgattctaccttgctaacagacgct
tctggcaagctttatttgctggtagatgtctttcctgagtcacagggcgctgttgcatct
aaagcaggctcaggctatgaatggattaacggtcagtattatttaaacctttatgatttt
gataatcataaatatactgtacgtgaggagggcattgtttacgacagtaatggcaagaag
acagatatgtatgttgatgagggcaattttgagacagcctttagcacgcgcggcaacctc
tatcaaacaggggcaggagaggatattctactagggaatatttatctgagaagtggtcgc
actaagcagggcattactagagaaggctcgcaaacagctcctctatttacctacatgact
agctttttatggctgctaaccagtgaagacgaagggcaaacctggtctacacctcttgat
gtcacgccacaaatcaaagaagattggatgggatttttaggtacgggtgccgcagctggc
attgaaatagacgcagtcaatgcagagggtgagcaggtgaaacggttagttttcccgatt
tactataccaatcaacaaaatgcgacatcagctagtctaggtcgtcaaagtagtgctaat
atttttagtgatgatggcggtcaaacatggcaacgaggtgaatcaccaaatgatggcaga
atttatggtcataaccaacaaacaacctctaaggattttgatacatcagtcacagaattg
acagaaaatcaaatcattcagctaaacaatggtcacttattacagtttatgcgcaatacc
ggaaagacaatcgttattgccagaagcacagattacggtgcaacctgggacgataatcct
acaatcacagacctgccagagccttatgtcaatttgtcagctattcatatgatggttgat
ggcaaggaatatgttgtcttatccaatcctttaggagagccttcaggtgagcagttgacg
attagaaatcaacgcatgaaagggattttgcgtgtcggcgaagttttagaggacgacagt
attgattgggtggcttcaaccatttttgagccaaagcgctttgcttactctagcttggtt
caactagacgacgagagggttggtttgttatacgaatatagtggtcagatcacctattca
acctttaatatcaagcagatgatctcagaccagtttcgtgaggataaggctgaaattgaa
gaagtaacaataacgtcagcagctccaaagcagagtggcaaagcaagcataaccattcag
atgacctttaatcaaccgatgtttattcttggtgatcgtcagttagcagttactgtaaat
ggcgtagataagcttgccagctatgtttcaggagatggcacagacacagcgatatttgaa
ttgtctctggagagtatgcctgaaggaccgataactgttttaccgcagtttgaccatact
attgttgaaaccaaatacggcattagattgacagatgacaagacctataccctgtcttat
cctgatcctgctacagcctaa

DBGET integrated database retrieval system