KEGG   Streptococcus equi subsp. zooepidemicus ATCC 35246: SeseC_00453Help
Entry
SeseC_00453       CDS       T02355                                 

Gene name
alaA
Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sezo  Streptococcus equi subsp. zooepidemicus ATCC 35246
Pathway
sezo00220  Arginine biosynthesis
sezo00250  Alanine, aspartate and glutamate metabolism
sezo00290  Valine, leucine and isoleucine biosynthesis
sezo01100  Metabolic pathways
sezo01110  Biosynthesis of secondary metabolites
sezo01130  Biosynthesis of antibiotics
sezo01210  2-Oxocarboxylic acid metabolism
sezo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sezo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SeseC_00453 (alaA)
   00290 Valine, leucine and isoleucine biosynthesis
    SeseC_00453 (alaA)
   00220 Arginine biosynthesis
    SeseC_00453 (alaA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sezo01007]
    SeseC_00453 (alaA)
Enzymes [BR:sezo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SeseC_00453 (alaA)
    2.6.1.66  valine---pyruvate transaminase
     SeseC_00453 (alaA)
Amino acid related enzymes [BR:sezo01007]
 Aminotransferase (transaminase)
  Class I
   SeseC_00453 (alaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AEJ24606
LinkDB All DBs
Position
392094..393308
Genome map
AA seq 404 aa AA seqDB search
MKIIEKSSKLEHVAYDIRGPVLDEANRMIANGEKILRLNTGNPAAFGFEAPDEVIRDLIL
NARSSEGYSDSKGIFSARKAIMQYCQLKGFPDVDIDDIYLGNGVSELISMSLQALLDNGD
EVLVPMPDYPLWTACVSLGGGHAVHYLCDEEAEWYPDIADIKAKITERTKAIVIINPNNP
TGALYPREVLEEIVAIAREHQLIIFADEIYDRLVMDGGEHIAIASLAPDVFCVSMNGLSK
SHRIAGFRVGWMVLSGPKRHVRGYIEGLNMLANMRLCSNVLAQQVVQTSLGGRQSVDELL
LPGGRIFEQRNFIYQAINAIPGLSAVKPKAGLYLFPKIDRSMYRIDDDEEFVLQLLKQEK
VMLVHGRGFNWKEPDHFRVVYLPTVEELTDVQEKITRVLKQYKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataattgaaaaatcatcaaaattagaacacgtagcctacgatattcgaggtcca
gtcctggacgaggctaatcgtatgatagctaatggtgaaaagatccttcgattaaataca
ggtaacccagcagcctttggctttgaggctccagatgaggttattcgtgatttgatcctc
aatgctcgctccagcgagggctattctgatagtaaggggattttttcagcccgtaaggcc
atcatgcaatattgtcagctaaagggctttcctgatgttgacattgatgatatttatttg
ggaaatggtgtctcagagctgatttcgatgtctcttcaagccttgctcgataatggtgat
gaggtgctggtgccaatgcctgactatcccctttggacagcctgtgtcagcctaggtggt
gggcatgcggtgcattacctgtgtgatgaagaggctgaatggtatcctgatattgctgac
ataaaagccaagatcactgagcgcacaaaggctatcgtcattatcaatcccaataaccca
acaggtgctctctaccctcgagaggtcttagaggagattgttgcaattgccagagagcat
cagctcatcatttttgcagatgagatttatgatcgtttggtcatggacggtggggagcat
atcgcaattgccagccttgcacctgatgttttttgcgtgtcaatgaatgggctgtcaaaa
tcacaccgtattgccggctttcgagtgggctggatggtcttgtcaggtcctaaaagacat
gtcagaggttacattgaaggcttgaacatgctggcaaacatgcgcttgtgctccaatgtc
ttggcgcagcaggtggtgcagacctccttaggaggacgtcagtctgttgatgagctcttg
cttccgggtggtcgcatctttgagcaacgtaacttcatttaccaggcgatcaatgccatt
ccaggcctatcagctgtaaagcctaaggcaggcctctatttgtttccgaaaattgatcga
agcatgtaccgcattgatgatgatgaggaatttgtcctacagcttttgaagcaagaaaag
gtcatgctggtacatgggcgtggcttcaactggaaggagcctgatcattttcgcgtggtc
tatctgccaacagtggaagagctaactgacgtgcaagaaaagatcacgcgtgttctcaag
caatacaagcgctaa

DBGET integrated database retrieval system