KEGG   Streptococcus equi subsp. zooepidemicus ATCC 35246: SeseC_00967Help
Entry
SeseC_00967       CDS       T02355                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sezo  Streptococcus equi subsp. zooepidemicus ATCC 35246
Pathway
sezo00620  Pyruvate metabolism
sezo00680  Methane metabolism
sezo01100  Metabolic pathways
sezo01120  Microbial metabolism in diverse environments
sezo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sezo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SeseC_00967 (ppc)
  Energy metabolism
   00680 Methane metabolism
    SeseC_00967 (ppc)
Enzymes [BR:sezo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SeseC_00967 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Pro_dh
Motif
Other DBs
NCBI-ProteinID: AEJ25009
LinkDB All DBs
Position
799759..802530
Genome map
AA seq 923 aa AA seqDB search
MSVKKLESYNNQEIIAEEVAILKEILESITRRMIGDEAFARIEEIIELSEKQDYVLLEQL
IAKISNKDMEFISRYFSILPLLINISEDVDLAYEINRQNNTNQDYLGKLALTIASAAEKE
NAKELLERVTVVPVLTAHPTQVQRKTVLELTNSIHNLLRRYRDVKAGVMNQNKWYSELYR
YIDILMQTDIIREKKLKVKNEITNVMQYYNSSLIQAITALTSKYKTLAKDKGILLDNPKP
INMGMWIGGDRDGNPFVTAETLRLSATVQSEVILRFYIDKLSALYQTFSLSSALTKTSPE
VERLASLSSDQSIYRENEPYRRAFHYIQARLTQTLQELIGQPASASLAATRSATVGSLRS
GAANSDDQQAPAYKTAAAFKADLVLIEQSLIAAGDSSLIEGDLQEVLQAVDIFGFFLASI
DLRQDSSVQEACVAELLKNAGIVEDYSALSEEQKCEVLLKELTEDPRTLSSAAVEKSELL
EKELAIYAAARELKDKLGEEVIKQHIISHTESVSDMFELAIMLKEVGLIDQHQARVQIVP
LFETIEDLDNARAIMTQYLSYDIVKSWIVTNAGYQEIMLGYSDSNKDGGYLASGWTLYKA
QNELTKIGEDNGVSITFFHGRGGTVGRGGGPSYEAITSQPFGSIKDRIRLTEQGEIIENK
YGNQDVAYYNLEMLISASINRMVTRMLTNPDEIDGFRKIMDEIVEDSKRIYRELVFDNPH
FYDYFFEASPIKEVSSLNIGSRPAARKTITDISGLRAIPWVFSWSQNRIMLPGWYAVGSA
FKRFIDKEEGNLAKLQHMYDKWPFFHSLLSNVDMVLSKSNMNIAFQYAQLAESKEVCEVF
HTILDEWQLTKNVILAIAQHDELLEETPSLKQSLDFRLPYFNVLNYIQIELIKRLRHEQL
DEDYEKLIHTTINGIATGLRNSG
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
ttgtcagtcaaaaaattagagagctataataatcaggagattattgctgaagaggttgct
atcctaaaggaaatacttgagagcattacgcgtcgcatgattggtgatgaggcctttgca
aggattgaggaaattatagagctatccgaaaaacaggattatgtgcttctagagcaattg
atcgctaagattagcaataaagatatggaatttatttcacgatatttttcgattcttccg
ctgttgattaatatttcagaggacgttgatttggcttatgaaatcaatcgtcaaaacaat
acaaatcaagactatctgggaaagcttgctctgaccattgcttctgctgctgaaaaggaa
aatgcaaaggaactgttggaaagggtgacagtggttccagtcttgacagcccacccaaca
caggttcagcgaaaaacagttctagagttgaccaatagcattcataaccttcttcgtcgc
tatcgtgatgtcaaagcaggtgtcatgaatcaaaacaaatggtatagtgagctgtaccgt
tacattgatattctcatgcagacggatatcattcgtgagaaaaagctcaaggtcaaaaat
gagattaccaatgtcatgcagtattacaatagctctctgatacaggcgatcacagcgctg
acaagcaagtataagacgctggccaaggacaaggggatcttgctggacaatccaaagccg
attaacatgggcatgtggatcggaggggaccgagatggcaatccttttgtcacagcagag
acactgaggctgtctgcaacagtccaaagtgaggttatcctgcgcttttacattgacaaa
ttgtcagctctttatcaaaccttttcgctgtcgtcagccttgacaaagaccagtcctgag
gtggagcgtctggccagtctatctagtgatcagtccatttatcgtgagaatgagccctac
cgcagagcttttcactatattcaggctcgtctaacccaaaccctgcaggagctaattggt
cagccggcctcagctagtctagcagccacaaggtccgctacagtaggctcacttcggtca
ggtgctgcaaattctgatgaccagcaagcaccagcctataaaacagcagcagcatttaag
gctgatctggttttaattgagcaatctctcattgcagctggggactcttctttgattgag
ggggatttgcaggaggtcctgcaagcagttgatatttttggtttctttttggccagcatt
gatttgcggcaggattctagtgtgcaggaggcctgtgttgctgagcttttgaaaaacgct
ggtattgttgaggattacagtgctttgtcagaggagcaaaaatgcgaggtcctcttaaag
gagctgacagaagacccacgcaccctctcatcggcagctgttgaaaagtcagagctatta
gaaaaggagcttgctatctatgcagcggcacgtgagctcaaggataagcttggtgaagag
gtgattaagcagcacatcatttcacatacagagagtgtttctgatatgtttgagctggct
atcatgctaaaggaggttggtctcattgaccagcatcaggcgcgcgtgcaaattgtacct
ttatttgaaacgattgaggatttggataatgctagagctatcatgacacaatatcttagc
tatgatatcgtcaagtcctggattgttacaaatgctggctatcaagagattatgcttggg
tattcagatagcaacaaggacggtggctatttagcatctggctggacactttacaaggcg
caaaatgagctgaccaaaatcggtgaggacaatggtgtcagcatcactttctttcatggt
cgtggtgggactgttggacgtggtggcggcccatcctatgaggcaatcacctcacagcca
tttgggtctattaaagaccgaatccgcctgactgagcagggtgagattattgaaaacaaa
tatggcaatcaagatgtggcttactacaacttggaaatgctgatttctgcttctatcaat
cgcatggtgactcgcatgctgacaaatcccgatgagattgatggctttaggaaaatcatg
gacgagattgttgaagatagtaagcgtatttatcgagagctggtttttgacaatccgcat
ttctatgactatttctttgaagccagtccgattaaggaggtatcaagcttaaacattggt
tctcgccctgctgctcgtaaaaccattacagacatctcaggcctgcgtgccattccttgg
gtattttcttggtcacaaaaccggatcatgcttccaggctggtatgcagtaggctctgcc
tttaagcgctttattgacaaagaagaaggaaatttggctaaattacagcacatgtatgac
aaatggcccttctttcattccttgctgtctaatgttgatatggtattgtcaaaatcaaac
atgaacattgcctttcaatatgcgcagttagcagaaagcaaggaggtctgtgaggtcttt
cataccattcttgatgagtggcagctgactaagaacgttattcttgctatcgcacagcat
gatgagcttcttgaggaaaccccgtccttgaagcaaagcttggatttccgcctcccatat
tttaatgtgttaaactacattcagattgagctgattaagcgtcttcgtcatgagcagcta
gatgaggactatgaaaagctgatccacacaactattaatggtattgctacaggacttcgt
aattccggctaa

DBGET integrated database retrieval system