KEGG   Streptococcus equi subsp. zooepidemicus ATCC 35246: SeseC_01577Help
Entry
SeseC_01577       CDS       T02355                                 

Gene name
aceF
Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sezo  Streptococcus equi subsp. zooepidemicus ATCC 35246
Pathway
sezo00010  Glycolysis / Gluconeogenesis
sezo00020  Citrate cycle (TCA cycle)
sezo00620  Pyruvate metabolism
sezo01100  Metabolic pathways
sezo01110  Biosynthesis of secondary metabolites
sezo01120  Microbial metabolism in diverse environments
sezo01130  Biosynthesis of antibiotics
sezo01200  Carbon metabolism
Module
sezo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sezo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SeseC_01577 (aceF)
   00020 Citrate cycle (TCA cycle)
    SeseC_01577 (aceF)
   00620 Pyruvate metabolism
    SeseC_01577 (aceF)
Enzymes [BR:sezo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SeseC_01577 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: AEJ25514
LinkDB All DBs
Position
complement(1323947..1325353)
Genome map
AA seq 468 aa AA seqDB search
MAVEIIMPKLGVDMQEGEIIEWKKQEGDTVSEGDILLEIMSDKTNMELEAEDSGVLLKIT
RQAGETVPVTEVIGYIGAAGESVDGSASSKKATETPVPTTSSANAVTASKEAASTAPQVA
SAANAPAFGEKVRATPAARKAASEMGIELNQVPGTGPKGRIHKEDVEGFKGAQPKATPLA
RKIAADKGVDLAAVVGTGIGGKITKEDILAVLGAAAPAVEKASIAEEKPAKELPEGVEIK
KMSAMRKAISKGMTHSYLTAPTFTLNYDIDMTEMIALRKKLIDPIMAKTGLKVSFTDLIG
LAVVKTLMKPEHEYMNASLINDANDIELHRFVNLGIAVGLDDGLVVPVVHGADKMSLSEF
VLASKDVIKKAQGGKLKAAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGIGATIPTP
TVVDGEIVARPIMAMCLTIDHRLVDGMNGAKFMVDLKKLMENPFELLI
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcgaaattattatgccaaagctcggtgttgacatgcaagaaggcgagatcatc
gagtggaaaaagcaggagggtgacactgtcagcgagggtgacattcttcttgaaatcatg
tcagacaagacaaatatggagcttgaagcagaggactcaggtgtgcttctaaaaatcact
cgccaggcaggtgaaacagtccctgtcactgaggttatcggctatattggtgctgcgggt
gaatctgttgatggctctgcttcaagtaaaaaagcaactgaaaccccagtaccaacaaca
tcatcagctaatgcagtaactgcctcaaaagaagcagcttcaacagcgcctcaggtagca
tcagctgccaatgctccagctttcggagaaaaggttcgcgcaacgccagcagctcgtaaa
gcagcttcagaaatgggaattgagcttaaccaagtaccaggaacaggaccaaaaggccgt
atccacaaagaagacgttgaaggtttcaagggagctcagcctaaggcaacgccacttgct
cgtaagatagctgccgacaagggagttgaccttgcagcagtggtcggaacaggtattggt
ggcaagattaccaaggaggacattttggctgtgcttggcgcagcagcacctgctgtggaa
aaagcatctattgctgaagaaaagcctgctaaggagcttccagagggtgttgaaattaag
aagatgtctgctatgcgtaaggctatttcaaagggtatgacacattcctaccttacagca
ccaacctttacgcttaattatgacattgacatgaccgaaatgattgccttgcgtaagaag
ctgattgacccaatcatggctaaaacagggctaaaggttagctttactgatttgattggt
ttagccgttgttaagaccttgatgaagccagagcacgaatacatgaatgcgtcattgatt
aatgatgctaatgatattgagcttcatcgctttgtcaaccttggtattgctgtaggactt
gatgatgggctagttgtgccggttgttcatggtgcagataagatgagtctctcagagttt
gtccttgcttctaaggacgttatcaaaaaggctcaaggaggcaagctaaaggctgccgaa
atgtcaggctcaaccttctccatcacaaatctgggtatgtttggcaccaaaaccttcaat
ccaattatcaatcagcctaattcagctattctaggtattggggcaaccattccaacccca
acagtggtcgatggtgagattgttgcacgtccaatcatggcaatgtgtctgacaattgat
caccgcctggtggacggcatgaatggtgctaaattcatggttgatctcaaaaaattgatg
gaaaatccatttgaactgctaatctga

DBGET integrated database retrieval system