KEGG   Streptococcus equi subsp. zooepidemicus ATCC 35246: SeseC_01707Help
Entry
SeseC_01707       CDS       T02355                                 

Gene name
tufA
Definition
(GenBank) elongation factor Tu (EF-Tu)
  KO
K02358  elongation factor Tu
Organism
sezo  Streptococcus equi subsp. zooepidemicus ATCC 35246
Brite
KEGG Orthology (KO) [BR:sezo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:sezo03012]
    SeseC_01707 (tufA)
   03029 Mitochondrial biogenesis [BR:sezo03029]
    SeseC_01707 (tufA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sezo04147]
    SeseC_01707 (tufA)
Translation factors [BR:sezo03012]
 Eukaryotic Type
  Elongation factors
   SeseC_01707 (tufA)
 Prokaryotic Type
   SeseC_01707 (tufA)
Mitochondrial biogenesis [BR:sezo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SeseC_01707 (tufA)
Exosome [BR:sezo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SeseC_01707 (tufA)
  Exosomal proteins of breast cancer cells
   SeseC_01707 (tufA)
  Exosomal proteins of colorectal cancer cells
   SeseC_01707 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AEJ25617
LinkDB All DBs
Position
complement(1430326..1431540)
Genome map
AA seq 404 aa AA seqDB search
MEAFPKMAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARRLPSSVNQPKDYASID
AAPEERERGITINTAHVEYETATRHYAHIDAPGHADYVKNMITGAAQMDGAILVVASTDG
PMPQTREHILLSRQVGVKHLIVFMNKVDLVDDEELLELVEMEIRDLLSEYDFPGDDLPVI
QGSALKALEGDSKYEDIIMELMDTVDSYIPEPERDTDKPLLLPVEDVFSITGRGTVASGR
IDRGTVRVNDEIEIVGIRDEIKKAVVTGVEMFRKQLDEGLAGDNVGVLLRGVQRDEIERG
QVIAKPGSINPHTKFKGEVYILTKEEGGRHTPFFNNYRPQFYFRTTDVTGSIELPAGTEM
VMPGDNVTIDVELIHPIAVEQGTTFSIREGGRTVGSGIVSEIEA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
ttggaggcttttcctaaaatggcaaaagaaaaatacgatcgtagtaaaccccacgttaac
attggtacaattggacacgttgaccatggtaaaactactttaacagctgcaatcacaact
gttcttgcacgtcgtctaccaagctcagttaaccaaccaaaagactacgcttcaatcgat
gctgctccagaagaacgcgaacgcggaatcactatcaacactgcacacgttgagtatgaa
actgctacacgtcactatgcgcacatcgacgcaccaggacacgcggactacgttaaaaac
atgatcactggtgccgctcaaatggacggagctatccttgtagttgcttcaactgacgga
ccaatgccacaaactcgtgagcacatccttctttcacgtcaggttggtgttaagcacctt
atcgttttcatgaacaaggttgaccttgttgacgacgaagaattgcttgagcttgttgaa
atggaaattcgtgaccttctttcagaatacgatttcccaggtgatgaccttccagttatt
caaggttcagcgcttaaggctcttgaaggcgacagcaaatacgaagatatcatcatggaa
ttgatggatactgttgattcatacattccagaaccagaacgtgacacagacaagccattg
cttcttccagtcgaggacgtattctcaatcactggacgtggtactgttgcttcaggacgt
atcgaccgcggtactgttcgtgttaacgacgaaatcgaaatcgttggtatcagagacgag
atcaaaaaagcagttgttactggtgtagaaatgttccgtaaacagcttgatgaaggtctt
gcaggagacaacgttggtgttcttcttcgtggtgtacaacgtgatgaaattgaacgtggt
caagttattgctaagccaggttctatcaacccacacactaaattcaaaggtgaagtatac
atccttactaaagaagaaggtggacgtcacacgccattcttcaacaactatcgtccacaa
ttctacttccgtactactgacgtaacaggttcaatcgagcttccagcaggtacagaaatg
gttatgcctggtgataacgtgactattgacgttgagttgatccacccaatcgccgtagaa
caaggtactacattctcaattcgtgaaggtggacgtactgttggttcaggtatcgtttca
gaaatcgaagcttaa

DBGET integrated database retrieval system