KEGG   Streptococcus equi subsp. zooepidemicus ATCC 35246: SeseC_02102Help
Entry
SeseC_02102       CDS       T02355                                 

Gene name
divI
Definition
(GenBank) cell division initiation protein DivIVA
Organism
sezo  Streptococcus equi subsp. zooepidemicus ATCC 35246
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DivIVA ATG16 HALZ APC_N_CC FTCD_C DivIC TLE_N ZapB DUF4407
Motif
Other DBs
NCBI-ProteinID: AEJ25905
LinkDB All DBs
Position
complement(1733798..1734121)
Genome map
AA seq 107 aa AA seqDB search
MTGIIYSPKDIFEQEFKTSMRGFDKKEVDEFLDNVIKDYEYFNAQIEALKAENEALKKAK
AQVRDPLAGSSQAVSQPTRVAQSATNFDMLKRISKLEKEVFGKQIIE
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgacaggtataatttatagtccaaaggacatttttgagcaagaatttaagaccagtatg
cgtggctttgataagaaggaggtcgacgaattccttgataacgtcatcaaggattatgag
tatttcaatgctcagatcgaggccctaaaggctgaaaatgaagccttaaaaaaggctaag
gctcaggtgcgtgatcctttagcaggcagctctcaggcggtatcacagccaaccagagta
gcacagtcagccaccaattttgacatgctaaagcgcattagcaagctggaaaaagaggtt
tttggaaagcaaattattgagtaa

DBGET integrated database retrieval system