KEGG   Streptomyces pratensis: Sfla_0961Help
Entry
Sfla_0961         CDS       T01647                                 

Definition
(GenBank) aminotransferase class-III
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00250  Alanine, aspartate and glutamate metabolism
sfa00410  beta-Alanine metabolism
sfa00640  Propanoate metabolism
sfa00650  Butanoate metabolism
sfa01100  Metabolic pathways
sfa01120  Microbial metabolism in diverse environments
Module
sfa_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Sfla_0961
   00650 Butanoate metabolism
    Sfla_0961
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sfla_0961
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sfla_0961
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sfa01007]
    Sfla_0961
Enzymes [BR:sfa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Sfla_0961
Amino acid related enzymes [BR:sfa01007]
 Aminotransferase (transaminase)
  Class III
   Sfla_0961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADW02417
UniProt: E8WEL7
LinkDB All DBs
Position
complement(1106863..1108146)
Genome map
AA seq 427 aa AA seqDB search
MTGLYERHLAVSPEWLALYYRNPLELTHGEGRHVWDADGNRYLDFFGGILTTMTAHALPE
VTKAVSEQAGRLIHSSTLYLNRPMVELAERIAALSGIPDARVFFTTSGTEANDAALLLAT
AHRASNQILAMRNSYHGRSFSAVSITGNRSWSTTSLSPLQTLYVHGGVRTRGPYAELSDE
RFIRACVADLEDLLGHTRGVAALIAEPVQGVGGFTAPPDGLYAAFREVLDRHGILWISDE
VQTGWGRTGDHFWGWQAHAASGPPDILTFAKGIGNGMSIGGVVARADVMNCLDANSISTF
GGSPVTMAAGLANLSYLLEHDLQGNARRVGGLLVERLRAVGAGSPAVREVRGRGLMIGIE
LVKPGTDEADPEAAAAVLEAARAGGLLIGKGGGHNTSVLRIAPPLSLTVAEAEEGAEILG
EALHAAA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggactgtacgaacggcacctggccgtcagcccggagtggctggcgctctactac
cgcaaccccctcgaactcacccatggcgaggggcgccacgtctgggacgcggacggcaac
cgctacctcgacttcttcggcggcatcctcaccacgatgaccgcgcacgccctgcccgag
gtgaccaaggccgtctcggagcaggcaggccgtctcatccactcctcgacgctctacctc
aaccgccccatggtcgagctcgccgagcggatcgccgccctctccggaatccccgacgcc
cgggtcttcttcaccacctcgggcaccgaggccaacgacgcggccctgctgctggccacc
gcccaccgcgcgtccaaccagatcctggcgatgcgcaacagctaccacggcaggtcgttc
tcggcggtgtccatcacgggcaacaggtcctggtcgaccaccagcctgtcgcccctgcag
acgctctacgtccacggcggggtccgcacccgaggaccgtacgccgagctgagcgacgaa
cggttcatcagggcctgtgtggccgatctggaggacctgctcggccacaccaggggcgtc
gcggcgctgatcgccgaacccgtgcagggggtcggcgggttcaccgcaccccccgacggg
ctgtacgcggcgttccgcgaggtcctcgaccggcacggcatcctgtggatctccgacgag
gtgcagacggggtggggacgcaccggcgaccacttctggggctggcaggcccacgcggcg
agcgggccgcccgacatcctcaccttcgccaagggcatcggcaacggcatgtccatcggc
ggagtcgtcgcccgggcggacgtcatgaactgcctcgacgccaactccatctcgacgttc
ggcggatccccggtcaccatggcggcgggcctcgccaacctctcctacctgctggagcac
gacctccagggcaacgcccggcgggtcggcggcctgctcgtcgagcgcctgcgggcggtc
ggcgcgggttcacccgccgtacgggaggtacgcggccggggtctcatgatcggcatcgag
ctcgtgaagcccggcaccgacgaggccgacccggaggccgccgccgcggtcctcgaggcg
gcccgcgccgggggtctgctcatcggcaagggcggcggtcacaacaccagtgtgctgcgg
atcgcgccgccgctgtcgctgaccgtcgccgaggccgaggagggcgccgagatcctgggc
gaggcgctgcacgcggcagcctga

DBGET integrated database retrieval system