KEGG   Streptomyces pratensis: Sfla_2028Help
Entry
Sfla_2028         CDS       T01647                                 

Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
sfa  Streptomyces pratensis
Brite
Enzymes [BR:sfa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Sfla_2028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N
Motif
Other DBs
NCBI-ProteinID: ADW03462
UniProt: E8WCQ4
LinkDB All DBs
Position
2462851..2463246
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVKVSAHCDLPCGVYDPAQARIEAESVKAVQEKYQANEDADFRTRAVLIKEQ
RAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKALSAAKGSNDPATGQKALDLIAQ
IDTIFWETKKA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctttcccgcctgtttgcccccaaggtgaaggtcagcgcccactgcgacctgccctgc
ggcgtgtacgacccggcccaggcccgcatcgaggccgagtccgtcaaggccgtccaggag
aagtaccaggccaatgaggacgcggacttccgcacccgcgccgttctgatcaaggaacag
cgtgccgagctcgcgaagcaccacgtctcggtgctctggagcgactacttcaagcccccg
cacttcgagaagtacccggagctgcaccagctggtcaacgacaccctgaaggcgctctcc
gcggccaagggctcgaacgacccggccacgggccagaaggctctggacctgatcgcccag
atcgacacgatcttctgggagaccaagaaggcctga

DBGET integrated database retrieval system