KEGG   Streptomyces pratensis: Sfla_2282Help
Entry
Sfla_2282         CDS       T01647                                 

Definition
(GenBank) aminotransferase class I and II
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00220  Arginine biosynthesis
sfa00250  Alanine, aspartate and glutamate metabolism
sfa00290  Valine, leucine and isoleucine biosynthesis
sfa01100  Metabolic pathways
sfa01110  Biosynthesis of secondary metabolites
sfa01130  Biosynthesis of antibiotics
sfa01210  2-Oxocarboxylic acid metabolism
sfa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sfa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sfla_2282
   00290 Valine, leucine and isoleucine biosynthesis
    Sfla_2282
   00220 Arginine biosynthesis
    Sfla_2282
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sfa01007]
    Sfla_2282
Enzymes [BR:sfa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Sfla_2282
    2.6.1.66  valine---pyruvate transaminase
     Sfla_2282
Amino acid related enzymes [BR:sfa01007]
 Aminotransferase (transaminase)
  Class I
   Sfla_2282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Aminotran_3 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ADW03712
UniProt: E8WG01
LinkDB All DBs
Position
2738263..2739474
Genome map
AA seq 403 aa AA seqDB search
MQVIQSTKLSGVCYEIRGPVLEEAMRLEAAGHRILKLNTGNPAAFGFECPPEILEDILRN
LSGAHGYGDAKGLLSARRAVMQHYQTKGIDLDVEDVYLGNGVSELIQMSMQALLDDGDEV
LVPAPDYPLWTASVSLAGGTAVHYRCDEQADWMPDLADIERKITDRTKALVIINPNNPTG
AVYDDEMLRGLTEIARRHNLVVCSDEIYDRILYDGATHTPTAAIAPDLMVLTFNGLSKNY
RIAGYRSGWMAVCGPKAHASSYIEGLTILANMRLCANMPAQHAVATALGGRQSIDELVLP
GGRILEQRDVAYDLLTRIPGVTCVKPKGALYLFPRLDLKVFKIKDDRQMVLDLLRAEKIM
VVQGTGFNWPEPDHFRVVTLPPAKDLTDAVTRIGNFLDGYSQP
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcatccagtcaacgaagctctccggcgtctgttacgagatccgcggccccgtc
ctcgaagaggcgatgcggctcgaagccgcaggtcatcgcatcctcaagctgaacaccggg
aacccggccgcgttcgggttcgagtgcccgccggagatcctcgaggacatcctgcgcaac
ctgtccggcgcgcacggctacggcgacgcgaagggcctgctgtccgcgcgccgcgcggtg
atgcagcactaccagaccaagggcatcgacctggacgtcgaggacgtctacctgggcaac
ggcgtctccgagctgatccagatgtcgatgcaggcactgctcgacgacggcgacgaggtg
ctcgtccccgctccggactatcccctgtggacggcctcggtctcgctggccggcggcacg
gcggtgcactaccggtgcgacgagcaggccgactggatgcccgacctcgccgacatcgag
cggaagatcaccgaccgcaccaaggcgctggtgatcatcaacccgaacaatccgaccggc
gcggtctacgacgacgagatgctgcgagggctgacggagatcgcccggcgccacaacctg
gtcgtctgctccgacgagatctacgaccggatcctctacgacggcgcgacacacaccccg
accgccgcgatcgccccggacctgatggtcctcaccttcaacgggctctccaagaactac
cggatcgcgggataccgctccggctggatggcggtctgcggcccgaaggcgcacgcgtcc
tcgtacatcgagggcctgacgatcctggccaacatgcggctgtgcgccaacatgcccgcg
cagcacgcggtggccaccgcgctcggcgggcggcagtcgatcgacgaactggtgctgccg
ggcggccggatcctggaacagcgggacgtggcgtacgacctgctgacccggatccccggg
gtgacctgcgtgaagccgaagggggcgctctacctcttcccgaggctcgacctcaaggtc
ttcaagatcaaggacgaccggcagatggtcctcgacctgctgcgggccgagaagatcatg
gtggtgcagggcaccggattcaactggcccgagcccgatcacttccgggtggtcacgctg
ccgccggcgaaggacctgaccgacgcggtgacccgtatcggaaacttcctggacggctac
agccagccctga

DBGET integrated database retrieval system