KEGG   Streptomyces pratensis: Sfla_3770Help
Entry
Sfla_3770         CDS       T01647                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00620  Pyruvate metabolism
sfa00680  Methane metabolism
sfa01100  Metabolic pathways
sfa01120  Microbial metabolism in diverse environments
sfa01200  Carbon metabolism
Module
sfa_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sfla_3770
  09102 Energy metabolism
   00680 Methane metabolism
    Sfla_3770
Enzymes [BR:sfa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Sfla_3770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ADW05187
UniProt: E8W2X6
LinkDB All DBs
Position
4333390..4336119
Genome map
AA seq 909 aa AA seqDB search
MSSADQTPAANTELRADIRRLGDLLGETLVRQEGQDLLDLVERVRALTREDGEAAAELLG
DTDLETAAQLVRAFSTYFHLANVTEQVHRAHEMRDRRSAEGGLLARTADRLKDADPDHLR
ETVKNLNVRPVFTAHPTEAARRSVLNKLRRIAELLETPVIEADRRRQDIRLAENIDLIWQ
TDELRVVRPEPADEARNAIYYLDELHANAVGDVLEDLAAELERVGVELPAGTRPLTFGTW
IGGDRDGNPNVTPTVTWDVLILQHEHGITDALELVDQLRGLLSNSIRYTGATDELLTSLQ
TDLERLPEISPRYKRLNAEEPYRLKATCVRQKLVNTRERLASGTPHRPGCDYLGTAELIA
DLALIQTSLREHRGGLFADGRMDRTIRTLTAFGLQLATMDVREHADAHHHTLGQLFDRLG
EESWRYTDMPRDYRQKLLAKELRSRRPLAPTPAPLDAAGEKTLGVFHTISQAFERFGPEV
IESYIISMCQGADDVFAAAVLAREAGLLDLHGGWAKIGIVPLLETTDELKAADVILDEML
ADPSYRRLVSLRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVAHRYGVRLRLFH
GRGGTVGRGGGPSHDAILAQPWGTLEGEIKVTEQGEVISDKYLIPALARENLELTVAATL
QASALHTAPRQSDEALARWDAAMDTVSDAAHQAYRKLVEDPDLPAYFLASTPVDQLADLH
LGSRPSRRPGSGVSLDGLRAIPWVFGWTQSRQIVPGWFGVGSGLKALREAGLDTVLDEMH
EQWHFFQNFLSNVEMTLAKTDLRIARHYVDTLVPDELKHVFDVIQAEHELTVQEVLKVTG
GKELLGTNPVLQQTFAIRDAYLDPISYLQVSLLARQRQAAERGEEPDPLLARALLLTVNG
VAAGLRNTG
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgaccagacccctgccgccaacaccgaactgcgggcagacatccgccgc
ctcggagacctgctgggcgagaccctcgtacgacaggagggccaggacctcctcgacctc
gtcgaacgagtccgcgccctgacccgcgaggacggcgaggcagcggccgagctcctcggc
gacacggacctggagaccgccgcgcagctcgtgcgcgccttctccacctacttccacctc
gccaacgtcaccgagcaggtccaccgcgcccacgagatgcgcgaccgccggtccgccgag
ggcgggctcctcgcccgcaccgccgaccgcctcaaggacgccgaccccgatcacctgcgc
gagacggtcaagaacctcaacgtccggcccgtcttcaccgcacaccccaccgaagccgca
cggcgctccgtcctcaacaagctccgccgcatcgccgaactcctcgagaccccggtcatc
gaggccgaccgccgacgccaggacatccggctcgccgagaacatcgacctcatctggcag
accgacgaactccgcgtcgtccgcccggagcccgccgacgaggcccgcaacgccatctac
tacctcgacgaactccacgccaacgcggtcggcgacgtcctggaggacctcgccgcggag
ctggagcgcgtcggcgtcgaactgcccgccggcacccgcccgctcaccttcggcacctgg
atcggaggcgaccgcgacggcaaccccaacgtcacgcccaccgtcacctgggacgtgctc
atcctccagcacgagcacggcatcaccgacgccctcgaactcgtcgaccagctgcgcgga
ctgctctccaactccatccgctacaccggagccaccgacgagctcctcacctcgctccag
accgacctggaacgccttcccgagatcagcccccgctacaagcggctgaacgccgaggag
ccctaccggctcaaggccacctgcgtccgccagaagctcgtcaacacccgcgaacgcctc
gcctccggcaccccccaccgccccggctgcgactacctcggcaccgccgaactcatcgcc
gacctcgcactcatccagacctccctgcgcgaacaccgcggcggactcttcgccgacggc
cgcatggaccgcaccatccgcacgctcaccgcgttcggcctccagctcgccaccatggac
gtccgcgaacacgccgacgcccaccaccacaccctcggccagctcttcgaccggctcggc
gaggagtcctggcgctacaccgacatgccccgcgactaccggcagaagctcctcgccaag
gaactccgctcccgtcgccccctcgcccccaccccggcccccctggacgccgccggcgag
aagaccctcggggtcttccacaccatcagccaggccttcgaacgcttcggccccgaggtc
atcgagtcctacatcatctcgatgtgccagggcgccgacgacgtcttcgccgccgccgtc
ctcgcccgcgaggccggcctgctcgacctccacggcggctgggccaagatcggcatcgtg
ccgctcctggagaccaccgacgagctcaaggccgccgacgtcatcctcgacgagatgctc
gccgacccctcctaccgccggctcgtctcactccgcggcgacgtccaggaggtcatgctc
ggctactccgactcctccaagttcggcggcatcaccacctcccagtgggagatccaccgc
gcccagcgccggctccgcgacgtcgcccaccgctacggcgtacgcctgcgcctcttccac
ggccgcggcggcaccgtcggccgcggcggcggcccctcgcacgacgcgatcctcgcgcag
ccctggggcaccctcgaaggcgagatcaaggtgaccgaacagggcgaggtcatctccgac
aagtacctcatccccgccctcgcccgggagaacctggaactgaccgtcgcggccaccctc
caggcctccgccctccacaccgcaccccggcagtccgacgaggccctcgcccgctgggac
gcggccatggacaccgtctccgacgccgcccaccaggcctaccgcaagctcgtcgaggac
ccggacctgccggcctacttcctcgcctccaccccggtggaccagctcgccgacctgcac
ctgggctcgcggccctcccgccgccccggctcgggcgtctcactcgacggcctccgcgcc
atcccgtgggtcttcggctggacccagtcacgccagatcgtccccggctggttcggcgtc
ggctccggcctcaaggcactgcgcgaagccggcctcgacaccgtcctggacgagatgcac
gaacagtggcacttcttccagaacttcctctccaacgtcgagatgaccctcgccaagacc
gacctgcgcatcgcccggcactacgtcgacaccctcgtgcccgacgagctcaagcacgtc
ttcgacgtcatccaggcggaacacgaactcaccgtgcaggaggtcctcaaggtcaccggc
ggcaaggaactcctcggcaccaacccggtgctccagcagaccttcgccatccgcgacgcc
tacctggacccgatctcctacctccaggtgtccctgctcgcccgccagcgccaggccgcc
gaacgcggcgaggagccggacccgctcctcgcccgcgccctgctgctcaccgtcaacggt
gtcgccgcgggactccgtaacaccggctga

DBGET integrated database retrieval system