KEGG   Streptomyces pratensis: Sfla_4021Help
Entry
Sfla_4021         CDS       T01647                                 

Definition
(GenBank) DNA polymerase LigD, ligase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sfa  Streptomyces pratensis
Pathway
sfa03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Sfla_4021
Enzymes [BR:sfa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Sfla_4021
DNA repair and recombination proteins [BR:sfa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Sfla_4021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2 RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ADW05435
UniProt: E8W6T0
LinkDB All DBs
Position
complement(4642533..4643507)
Genome map
AA seq 324 aa AA seqDB search
MATLPLIAPMLATPGRLPPAAVDEQWAYEVKQDGQRAMAYLPGDGSIRLLARSGAVITPA
YPDLVALGPALGGVPAVLDGEIVALDEQGRSDFERLQSRMGLSGSPAKAARAAQRVPAHL
VLFDVVFLGDRSLVRLPWTERRAALEGLGLDGPHWSTPAVVVGHGEQALAMTREAGLEGL
VAKRLGSVYEPGVRARTWIKIRHARTADVIVGGWVPGRGRLGGLPGALLVGERHPGGLRY
AGSVGTGWSDAERARLAELLRVAAVDDCPFDDTPPVAGARWVLPRLVGEVRYATRTKAGR
LRQPSWHRLRPDLAPDDLAADDLG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggccaccctgcccctgatcgcccccatgctcgccaccccgggccggctgccgcccgcc
gccgtcgacgagcagtgggcgtacgaggtgaagcaggacggccagcgcgccatggcctat
ctgccgggggacggttcgatccggctgctggccaggtcaggggccgtcatcaccccggcg
tatccggatctggtggctctgggacccgcgctcgggggcgtaccggcggttctcgacggt
gagatcgtcgcgctggacgagcaggggcgcagcgacttcgagcggctgcagtcgcggatg
ggactctccggatcacccgcgaaggccgcccgcgcggcgcagcgggtaccggcgcacctg
gtgctgttcgacgtcgtgttcctgggcgacaggagcctcgtacggctgccgtggacggag
cgcagggccgcgctcgaagggctcgggctggacgggccgcactggtcgacgcccgccgtg
gtcgtggggcacggcgagcaggccctggccatgacgcgggaggccgggctggaggggctg
gtcgcgaagcggctgggctcggtgtacgaaccgggcgtccgcgcgcgtacctggatcaag
atccgccatgcccgcacggcggacgtgatcgtcggcggctgggtgccgggccggggccgg
ctgggcggcctgccgggggcgctgctggtcggcgaacggcacccgggcggcctgcgctac
gcgggcagcgtgggcaccgggtggagcgacgcggagagggccaggctcgccgaactgctc
cgggtcgccgccgtcgacgactgtccgttcgacgacacacccccggtggccggcgcccgg
tgggtgctgccccggctcgtcggcgaggtgcggtacgcgacccggacgaaggcggggcgg
ctgcgccagccgtcctggcaccggctgcggccggacctcgcgccggacgacctcgcagcg
gacgacctcgggtga

DBGET integrated database retrieval system