KEGG   Streptomyces pratensis: Sfla_5121Help
Entry
Sfla_5121         CDS       T01647                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00010  Glycolysis / Gluconeogenesis
sfa00053  Ascorbate and aldarate metabolism
sfa00071  Fatty acid degradation
sfa00280  Valine, leucine and isoleucine degradation
sfa00310  Lysine degradation
sfa00330  Arginine and proline metabolism
sfa00340  Histidine metabolism
sfa00380  Tryptophan metabolism
sfa00410  beta-Alanine metabolism
sfa00561  Glycerolipid metabolism
sfa00620  Pyruvate metabolism
sfa00625  Chloroalkane and chloroalkene degradation
sfa00903  Limonene and pinene degradation
sfa01100  Metabolic pathways
sfa01110  Biosynthesis of secondary metabolites
sfa01120  Microbial metabolism in diverse environments
sfa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfla_5121
   00053 Ascorbate and aldarate metabolism
    Sfla_5121
   00620 Pyruvate metabolism
    Sfla_5121
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Sfla_5121
   00561 Glycerolipid metabolism
    Sfla_5121
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sfla_5121
   00310 Lysine degradation
    Sfla_5121
   00330 Arginine and proline metabolism
    Sfla_5121
   00340 Histidine metabolism
    Sfla_5121
   00380 Tryptophan metabolism
    Sfla_5121
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sfla_5121
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Sfla_5121
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sfla_5121
Enzymes [BR:sfa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Sfla_5121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADW06520
UniProt: E8W5P1
LinkDB All DBs
Position
5893570..5894964
Genome map
AA seq 464 aa AA seqDB search
MKAHDGMYIGGEWRPAAGPDTIAVVNPADEQVIGHVPAGTAEDVDAAVRAARAAFPGWAA
TPPAERAGRIAALRDVLAARKDEIAGTVTAELGSPLPLSQAVHAGVPVLVAGSYAELAAS
YAFEEKLGNSTVLLEPVGVVGAITPWNYPLHQIVAKVAPALAAGCTVVLKPAEDTPLTAQ
LFAEAVHEAGLPAGVFNLVTGIGAVAGQALSEHEGVDLVSFTGSTAVGRRIGATAGAAVK
RVALELGGKSANVILPGADLAKAVNVGVANVMSNSGQTCSAWTRMLVDAERYEEAVALAA
TAVAKYVPGERIGPVVNAEQQARVRGYIEKGVEEGARLVAGGPEAPRDQGYYVSPTVFAD
VTPDMTIAQEEIFGPVLSILRYEDVDDALRIANGTVYGLAGAVWGADDEEAVAFARRMDT
GQVDINGGRFNPLAPFGGYKQSGVGRELGPHGLSEYLQTKSLQF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgcatgacgggatgtacatcggcggggagtggcggcccgccgcgggcccggac
acgatcgcggtcgtgaacccggcggacgagcaggtcatcggccatgtcccggcgggtacg
gccgaggacgtcgacgcggccgtacgtgccgcacgggccgccttccccggctgggcggcc
accccgcccgccgagcgcgccgggaggatcgccgcgctgcgtgacgtactcgccgcccgc
aaggacgagatcgccgggacggtcaccgcggagctcggctcgccgctgccgctctcccag
gcggtgcacgccggcgtgccggtgctggtcgccggttcctacgccgaactcgccgcctcg
tacgccttcgaggagaagctgggcaactcgacggtcctgctggagcccgtcggcgtcgtc
ggcgcgatcacgccctggaactacccgctccaccagatcgtcgccaaggtggccccggcg
ctggccgcgggctgcaccgtcgtcctgaagccggccgaggacaccccgctcaccgcgcag
ctcttcgccgaggccgtccacgaggccggtctgcccgccggcgtcttcaacctggtcacc
ggcatcggggcggtcgcaggtcaggcgctgtccgagcacgagggcgtcgacctggtctcg
ttcaccgggtccacggccgtcggcaggcggatcggcgccaccgcgggagcggccgtcaaa
cgcgtcgccctggagctgggcggcaagtccgccaacgtgatcctgcccggtgccgacctc
gccaaggccgtcaacgtcggcgtcgccaacgtgatgtccaactccggccagacctgcagc
gcgtggacccggatgctggtcgacgccgagcggtacgaggaggccgtggcactcgccgcc
accgccgtcgccaagtacgtgccgggggagcggatcggcccggtcgtcaacgccgagcag
caggcccgggtccgcggatacatcgagaagggcgtcgaggaaggcgcccgcctcgtcgcg
ggaggccccgaggcgcccagggaccagggctactacgtcagccccacggtcttcgccgac
gtcaccccggacatgacgatcgcccaggaggagatcttcggcccggtcctctccatcctg
aggtacgaggacgtggacgacgccctgcggatcgccaacggcaccgtctacgggctggcc
ggcgcagtctggggcgcggacgacgaggaggccgtcgccttcgcccgccgcatggacacc
ggacaggtcgacatcaacggcggccgcttcaaccccctggcccccttcggcggttacaag
cagtccggggtgggccgtgaactcggcccgcacggcctctccgagtacctccagaccaag
tccctccagttctga

DBGET integrated database retrieval system