KEGG   Streptomyces pratensis: Sfla_5401Help
Entry
Sfla_5401         CDS       T01647                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00010  Glycolysis / Gluconeogenesis
sfa00053  Ascorbate and aldarate metabolism
sfa00071  Fatty acid degradation
sfa00280  Valine, leucine and isoleucine degradation
sfa00310  Lysine degradation
sfa00330  Arginine and proline metabolism
sfa00340  Histidine metabolism
sfa00380  Tryptophan metabolism
sfa00410  beta-Alanine metabolism
sfa00561  Glycerolipid metabolism
sfa00620  Pyruvate metabolism
sfa00625  Chloroalkane and chloroalkene degradation
sfa00903  Limonene and pinene degradation
sfa01100  Metabolic pathways
sfa01110  Biosynthesis of secondary metabolites
sfa01120  Microbial metabolism in diverse environments
sfa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfla_5401
   00053 Ascorbate and aldarate metabolism
    Sfla_5401
   00620 Pyruvate metabolism
    Sfla_5401
  Lipid metabolism
   00071 Fatty acid degradation
    Sfla_5401
   00561 Glycerolipid metabolism
    Sfla_5401
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sfla_5401
   00310 Lysine degradation
    Sfla_5401
   00330 Arginine and proline metabolism
    Sfla_5401
   00340 Histidine metabolism
    Sfla_5401
   00380 Tryptophan metabolism
    Sfla_5401
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sfla_5401
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Sfla_5401
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sfla_5401
Enzymes [BR:sfa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Sfla_5401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADW06798
UniProt: E8WA71
LinkDB All DBs
Position
6194079..6195539
Genome map
AA seq 486 aa AA seqDB search
MTSFFTDLAQQYVDGEWRPGKGSWDIIDFNPYSGEKLASITVATADEVDQAYRAAERTQP
DWADTNPYARRAVLEKALRVVEEREDEIGEAIVAELGGTRLKAGFELHLAKEFLREAAQL
TLRSTGQILPSPTEGKENRVYRLPVGVVGVISPFNFPFLLSLKSVAPALALGNAVVLKPH
QNTPICGGTLIAKVFEEAGLPAGLLNVVVTDIAEIGDSLLEHPVPQVISFTGSDRIGRHV
ARVCAAQLKRAVLELGGNSALIVLDDADVDYAVDAAVFSRYIHQGQVCMAANRILVDRAV
EQEFTEKFVAKVASLQVGDPADPATHIGPLISSSQADAVSKLVDETVAAGATALLHGRAE
GNVVSPSVLTGLAADAPVLQQEIFGPVALLVPFDGEDEAVRIANDTPYGLSGAVHTGNIE
RGVRVGQRIRTGMIHINDGTVHDEPIVPFGGEKNSGLGRLNGESMLEAFTTQKWISVQHG
RSQFPF
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgacttccttcttcaccgacctggcccagcagtacgtcgacggcgagtggaggccgggg
aaggggtcctgggacatcatcgacttcaacccgtacagcggggagaagctcgcctcgatc
accgtcgcgacggccgacgaggtcgaccaggcataccgggccgccgagcgcacccagccg
gactgggcggacacgaacccgtacgcccgccgggcggtgctggagaaggcgctccgcgtc
gtcgaggagcgcgaggacgagatcggcgaggcgatcgtcgcggagctcggcggcacccgg
ctgaaggcgggattcgagctgcacctggccaaggagttcctgcgcgaggccgcccagctc
acgctgcggtccaccgggcagatcctcccgtcgccgaccgagggcaaggaaaatcgcgtc
taccggctgcccgtcggtgtcgtgggagtcatcagccccttcaacttccccttcctgctg
tcgctgaagtcggtcgcccccgcactggccctgggcaacgccgtggtcctcaagccgcac
cagaacaccccgatatgcggcggcaccctgatcgccaaggtgttcgaggaagcgggtctg
cccgccgggctcctgaacgtcgtggtcaccgacatcgcggagatcggcgacagcctgctg
gagcaccccgtaccgcaggtcatctccttcaccggatcggaccggatcggccgtcacgtc
gcacgggtctgcgccgcccagctgaagcgcgcggtgctcgaactgggcggcaacagcgcc
ctgatcgtcctcgacgacgccgacgtggactacgccgtcgacgcggccgtcttcagccgc
tacatccatcagggccaggtctgcatggcggccaaccgcatcctggtggaccgcgcggtg
gagcaggagttcaccgagaagttcgtagccaaggtcgcctccctgcaggtcggcgacccg
gccgaccccgcgacccacatcggccccctgatcagctcctcgcaggccgacgcggtctcc
aagctcgtcgacgagaccgtggcggcgggtgccacggcactgctgcacggccgtgccgag
ggcaacgtggtcagcccgtccgtgctgaccggcctcgccgccgacgcccccgtcctccag
caggagatcttcgggccggtcgccctgctcgtccccttcgacggtgaggacgaggccgtc
cggatcgccaacgacaccccctacgggctgagcggcgcggtccacaccggcaacatcgag
cgcggcgtccgcgtggggcagcggatccgcaccggcatgatccacatcaacgacggcacg
gtccacgacgagcccatcgtccccttcggcggggagaagaactccggcctcggacggctg
aacggcgagtcgatgctggaggcgttcaccacgcagaagtggatctcggtccagcacggc
cgctcgcagttccccttctga

DBGET integrated database retrieval system