KEGG   Streptomyces pratensis: Sfla_6329Help
Entry
Sfla_6329         CDS       T01647                                 

Definition
(GenBank) oligopeptide/dipeptide ABC transporter, ATPase subunit
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
sfa  Streptomyces pratensis
Pathway
sfa02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sfa00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Sfla_6329
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sfa02000]
    Sfla_6329
Transporters [BR:sfa02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    Sfla_6329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_16 AAA_22 Mg_chelatase IstB_IS21 AAA_29 RsgA_GTPase DUF3265 AAA_5 NACHT ATP-synt_ab
Motif
Other DBs
NCBI-ProteinID: ADW07696
UniProt: E8W5W7
LinkDB All DBs
Position
7223948..7224907
Genome map
AA seq 319 aa AA seqDB search
MTAPVLSVRGLSVRFLMPSGRRIAAVTDAHFDVAAGECLALVGESGCGKSVLASALLGLL
PANAQAAGGAYLGDVDLLAADERTLARTVRGRLIGLIPQSPAAHLTPVRTVRSQLEETVV
ALTGTRGRAAVRQAAEAAAERAAFPAGHLDHHPHQLSGGLAQRAATALALIGNAPLLLAD
EPTTGLDRDLVHHTVDELRRQVDVGRRALLVITHDLAAAERIADRMAVMYAGRIVEISDA
TAFFGLPGPRHPYSRGLLGALPERDFIPIPGMPPELGDLPDGCAFAPRCERATPTCTTLP
AAAAGLVCHHPHVTEDLRA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccccagtcctttccgtgcgcggactctcggtgcgcttcctcatgcccagcgga
cgccggatcgccgccgtcactgacgcccacttcgacgtggcagcaggtgagtgtctcgcc
ctggtcggcgagagcggctgcggtaagtccgtccttgcctccgcgctcttgggcctgctg
cccgccaacgcgcaggccgcgggcggcgcatacctcggcgacgtggacctgctagccgcg
gacgaacgcaccctcgcccgcacggtacgcggccggctgatcgggctcatcccgcagagc
cccgccgcccacctcaccccggtccgcacggtccgctcccagttggaggaaacagtcgtc
gcgttgaccggcacgcgcggtcgggccgccgtgcgacaggcggccgaagcagccgccgaa
cgcgctgctttccccgccggccacctcgaccaccatccgcaccagctctccggcggcctc
gcccagcgcgccgccaccgcgctcgccctcatcggaaacgcacctctcctactcgccgac
gaaccaaccacaggtctcgaccgcgacctggtgcaccacaccgtcgatgagctgcgccgc
caagtggacgtcggccggcgagccctgctggtgatcacccacgacctggccgccgccgaa
cgcatcgccgaccgcatggccgtgatgtacgcgggccgcatcgtcgaaatcagcgacgcg
acagctttcttcggcctgccgggtcctcgtcacccctacagccgcggcctgctcggggcc
cttcctgaacgcgacttcatcccgattcccggcatgccgcccgaactcggagatctccca
gacggctgcgccttcgccccgcgttgcgagcgggctacccccacctgcaccaccctccct
gcggcggccgccgggctcgtctgccaccacccgcacgtgacggaggaccttcgtgcttga

DBGET integrated database retrieval system