KEGG   Spirochaeta africana: Spiaf_0415Help
Entry
Spiaf_0415        CDS       T01811                                 

Definition
(GenBank) theronine dehydrogenase-like Zn-dependent dehydrogenase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
sfc  Spirochaeta africana
Pathway
sfc00040  Pentose and glucuronate interconversions
sfc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Spiaf_0415
Enzymes [BR:sfc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     Spiaf_0415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Shikimate_DH Pyr_redox_2 3HCDH_N Methyltransf_25 ThiF UDPG_MGDP_dh_N Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: AFG36520
UniProt: H9UG77
LinkDB All DBs
Position
500892..501908
Genome map
AA seq 338 aa AA seqDB search
MEALVLEKVNQIAIRDIVIDETLGPRDVRVKPVCIGICGSDVHYYLHGRIGDFVVKEPMV
LGHEASGIVTEIGAEVTDLKVGDRVCMEPGIPDHNSEEYKLGIYNLDPAVRFWATPPIHG
CMRESVVHPAQFTFRLPDNVSFAEGALVEPVAIGVQAAKKAQIQPGDSALVLGAGTIGIV
TAMAAAASGCSNVYITDISAEKLDLVRERFGDRFTTVAHAQVGELHDAVDIVFEASGAAA
AVLAMARYARPGGRIVLIGMTQDPVPVDIVGIEVKELTMYSIFRYAHVFDRTLQFISSGK
IDVQPLVTHTYPFSESVAAYDFAASMPSDAIKVMIEKE
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtggaagcattagtactggagaaagtcaaccagatcgcgattcgggatatcgtgatagat
gagaccctggggccgagggatgtccgggtaaagccggtgtgcatcggtatctgcgggagt
gatgtgcattactacctgcatgggagaatcggcgattttgtggtgaaggagccgatggta
ctgggacacgaagccagcgggattgtaaccgagatcggtgccgaggtaaccgatctgaag
gtgggggaccgtgtctgcatggaaccgggaatccccgaccataacagcgaggagtacaag
ctgggaatctacaacctggatccggcggtacgattctgggcgaccccgccaatccatggc
tgcatgcgcgagagcgtggtgcatccggcccagtttacctttcgcctgcccgacaatgtc
tcgtttgccgagggggctctggtagagccggtggcgatcggggtacaggcagccaaaaag
gcacagattcagcccggggattctgccctggtgctgggcgccggtacgatcgggattgtt
accgcgatggccgccgctgcgtcggggtgcagcaatgtgtatataaccgatatcagcgcc
gagaagctggatctggtgcgggagcgattcggtgatcgctttaccacggttgcgcatgca
caggtgggtgagctgcatgatgccgtcgatattgtgttcgaggccagcggtgctgcagca
gcagtgctggccatggccaggtatgcccgcccgggcggccggattgtactgatcggcatg
acgcaggatccggtgccggtggacatcgtggggatagaggtaaaagagctcaccatgtac
tccatcttccgttatgcccatgtctttgatcgcaccctgcagtttatttcgtcggggaaa
atcgatgtacagccgctggtaacccacacctatccgttcagcgagtcggtagcagcctat
gattttgcggcatccatgccgagcgatgccatcaaggttatgatagaaaaggaatag

DBGET integrated database retrieval system