KEGG   Spirochaeta africana: Spiaf_2053Help
Entry
Spiaf_2053        CDS       T01811                                 

Definition
(GenBank) acetylornithine deacetylase ArgE
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
sfc  Spirochaeta africana
Pathway
sfc00220  Arginine biosynthesis
sfc01100  Metabolic pathways
sfc01110  Biosynthesis of secondary metabolites
sfc01130  Biosynthesis of antibiotics
sfc01210  2-Oxocarboxylic acid metabolism
sfc01230  Biosynthesis of amino acids
Module
sfc_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:sfc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Spiaf_2053
Enzymes [BR:sfc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     Spiaf_2053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AFG38101
UniProt: H9UKQ8
LinkDB All DBs
Position
2338206..2339378
Genome map
AA seq 390 aa AA seqDB search
MNRHRDLLLTVLSRLIAFPTVSDQSNLDLVSYVRELCEPHAALIHQVDDPDEPKASLLVR
FGPDAPGGILLSGHTDVVPADPEGWQSDPFRLEQRGDRLYGRGTADMKGFIAAVLAAILE
SPSSAAPGAQLQRPVYLALTYDEEVGCLAAPPLIESFRDRIAPLSAVLVGEPSGMQPVVA
NKGISEYITEFHGRSAHSSKPQLGINAIELAHHYAARILQLAADFRTTGQQNSCDPPYTT
IQLGTIAGGSATNVVPDYCRLSCDLRSFHDSDRQFFETEMAAVRQQLLQQYNLDPAAITT
SITCNVPPLEPRPDSTAIRLAQELTGETRLNRVPYATEAGQYQQAGYEAVILGPGSIEQA
HQRDEWISLAQLDSCQAMLQRLLALQSRPD
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgccaccgggacctgctgctgactgttctttcgcggctgatcgcattccctacg
gtctccgaccagtccaaccttgatctggtcagctatgtccgtgaactctgtgaaccccat
gccgcattgatccatcaggtagacgatcccgatgaacccaaggcatccctgctggtgcgg
tttggccccgatgcccctggcggcattctgttgtcgggccataccgatgttgtccccgcc
gatcccgagggctggcagtcagaccccttccggctggaacagcgcggggatcgactctac
ggccgcggaaccgcagacatgaaggggttcatcgcagcggtccttgccgccatcctggaa
tctccctcgtcagctgctccaggagcacaactgcagcggccggtatatctggctttgacc
tatgatgaagaggtcggctgcctggcggccccgccgttgatcgagtcctttcgcgatcgc
attgcgccgctgtccgcggtgctggttggcgagccgtccggcatgcagccggttgtcgcc
aacaaggggatcagtgagtacataaccgagttccacggacgttcagcccattcgagcaag
ccgcagctggggattaacgcgatcgagctggcccatcactacgcggcccggatactgcag
cttgcggcggattttcgcaccaccggtcagcaaaacagctgcgatcccccgtacaccacc
atacagctgggcaccatcgccggcggaagcgccaccaatgttgtcccggactactgccgc
ctcagctgtgatctgcgcagttttcatgatagcgaccgtcaattctttgaaaccgaaatg
gcagcggtacgccagcagctgctgcagcaatacaatctggaccctgcagcgatcaccacc
agtattacctgcaatgtcccgcccctggaaccccgtccggactccacggccatcagactt
gcacaggagctgaccggtgaaacccggttgaaccgggtgccctacgcaaccgaggctgga
cagtaccagcaggccggttacgaggccgttatcctgggcccggggtctattgaacaggca
caccagcgggatgaatggatatccctcgctcaacttgacagctgccaggcaatgctgcag
cgactgctggcgctgcaaagccgcccggactga

DBGET integrated database retrieval system