KEGG   Spirochaeta africana: Spiaf_2693Help
Entry
Spiaf_2693        CDS       T01811                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sfc  Spirochaeta africana
Brite
KEGG Orthology (KO) [BR:sfc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Spiaf_2693
Enzymes [BR:sfc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Spiaf_2693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 HI0933_like FAD_oxidored DAO Thioredoxin_3 Thi4 NAD_binding_8 NAD_binding_7 FAD_binding_3 AlaDh_PNT_C K_oxygenase Glutaredoxin DSBA FMO-like
Motif
Other DBs
NCBI-ProteinID: AFG38718
UniProt: H9UMH5
LinkDB All DBs
Position
complement(3078204..3079901)
Genome map
AA seq 565 aa AA seqDB search
MLDPAIQKQLREVFAPLQETILLSVRPSEHEKQQELRDLLQGLAETSEKIEVRVEGAESD
IPSFTVIRGGHSTGITFDCIPGGHEFTSLVLAVLNAGGQGRMPDQALQRRVAALQGPIEL
RSFISLSCTNCPDIVQALDQMALMHGNLRHTIVDGALVPEEVERLGIRGVPAVFVGDEML
HSGRSDFGSLLEKLEERFGGAADAPAAGASAGAADTASDRQAASGDAGTAAEPRQYDVLV
LGGGPAGAAAAIYSARKGLKTAVVAKRIGGQVNDTMGIQNLISVPSTEGPKLAADLRRHM
EDYPIELLENRSVLEVVPAESSASGLHTIRAKGGEQFAAPALVVATGAKWRELGVPGEAE
YIGRGVAFCPHCDGPFFAGKHVAVIGGGNSGVEAAIDLAGTCARVTLFEFADQLNADTVL
QDALHKLPNVRVITSARTTEIVGNGSAVTAIRWEDRQAGDAADNGGDTATADNNRELELD
GVFVQIGLLPNSEPVAEILHTNRFGEIEVDTHCRTSVPGIYAAGDVTTTPYKQIVVAMGE
GSKAALAAFEDRVRGTGVVLPSAAV
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatccagctattcagaaacagcttcgcgaggtgtttgcaccgctgcaggaaacc
atcctgctgtcggtgcggccgagcgaacacgaaaaacagcaggaactgcgggatctgctg
cagggcctggccgaaaccagtgagaagatcgaggtgcgggtagagggggccgagtcggac
atcccgtccttcaccgtgattcgcggcggccactccaccggcatcacctttgactgtatc
cccggcgggcacgagtttaccagtctggtactggcagtgctgaacgccggcggccagggg
cgtatgccggaccaggctctgcagcgtcgggtcgccgccctgcagggaccgatcgagctg
cgcagctttatctcgctgtcctgtaccaactgtccggatatcgtgcaggccctggatcag
atggcgctgatgcacggcaacctgcgccataccattgtggatggcgccctggttcccgag
gaggtcgaacggctggggatccgcggggtgccggcggtgtttgttggcgacgaaatgctg
cactccggccgctccgacttcggatcactgctggaaaagcttgaggaacgctttggcggc
gcggcagatgcgccggcagccggtgcgtctgccggtgcagcagacactgcctcagaccgg
caggcggcatccggggatgccggtactgccgccgagccgcgacagtacgatgtgctggtg
ctgggcggtggtcctgctggagcagcagccgctatctacagcgcccgcaaggggctgaaa
acagctgttgtggccaaacgcatcggcgggcaggtcaatgacaccatggggattcagaac
ctgatttcggtgccatccaccgaggggccgaaacttgcggccgatctgcgccgccacatg
gaagactatccgatcgagctgctggaaaaccgcagcgttctggaggtggtgccggcagag
agttcagcttccgggctgcacaccataagggccaaaggcggcgagcagtttgctgcccct
gccctggtagttgcgaccggtgccaagtggcgcgagctgggggttcccggagaggccgag
tacatcggtcgcggggtggccttctgcccgcactgcgacggcccgttctttgccggcaag
catgtcgccgtgatcggcggtggtaactccggtgtcgaggcagctatcgatctggccgga
acctgtgcccgggtcaccctgttcgagtttgctgatcagctgaacgccgacaccgtgctg
caggatgccctgcacaaactgcccaatgtccgggtgataacctcggcccgaactacagag
atagtcggtaacggcagcgcggtaaccgcaatccgctgggaggatcgccaggccggcgat
gctgcagacaatggcggcgacaccgcgactgccgataataatcgcgagctcgagctggac
ggggtgttcgtgcagatcggtctgctgcccaacagtgagccggttgccgaaatcctgcac
accaatcgatttggcgagatcgaggtggacacccactgtcgtacctcggtaccggggatc
tatgctgccggggacgtaaccactacaccctacaaacagatcgtggtagcgatgggcgag
ggcagcaaggccgcactggccgcattcgaggaccgtgtacgcggaaccggggtggtgctg
ccgtcagcggcggtgtaa

DBGET integrated database retrieval system