KEGG   Sinorhizobium fredii USDA 257: USDA257_c02520Help
Entry
USDA257_c02520    CDS       T02188                                 

Definition
(GenBank) alanine racemase, catabolic
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd00473  D-Alanine metabolism
sfd01100  Metabolic pathways
sfd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sfd00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    USDA257_c02520
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    USDA257_c02520
Enzymes [BR:sfd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     USDA257_c02520
Peptidoglycan biosynthesis and degradation proteins [BR:sfd01011]
 Precursor biosynthesis
  Racemase
   USDA257_c02520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Sulfate_transp
Motif
Other DBs
NCBI-ProteinID: AFL48850
UniProt: I3WYZ4
LinkDB All DBs
Position
279762..280895
Genome map
AA seq 377 aa AA seqDB search
MDRHALHIQGREAEAGAGASGYLTIDLAALRRNYQKLSAAVAPATVAAVVKADAYGLGAQ
QVSKALHAQGCRQFFVAHLAEAIELRSLLPNDTQIAVLNGLQPGAEITCAKANIVPVLNS
LEQFRRWSFTAQKLGRVLPTVLQFDTGMSRLGVPLQERTALAAVLKDCRSIEILFIMSHL
ACADEVDNKQNADQLAEMRLIAAEFADLDVCFANSGGVFLGRDYHGALSRPGIALYGGAP
IAGRPNPIEPVVRLDVAVIQTRTVPAGTRVGYGGAHVTSAETRLATIAAGYADGLPRSLS
DRGAVFFDGVRLPIVGRVSMDSITVDITALPEGTLSLGSLVEVLGPHQTLEDVAEAAGTI
SYEILTGLGRRYERRYR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggaccgtcatgctttgcatattcaaggtcgggaagcagaggccggcgctggggcttcc
ggctatctgaccattgaccttgccgcattgcgcaggaactatcagaagctttcggcggcg
gtcgcgcctgcaacggtcgccgccgtcgtcaaggccgacgcttatggcctaggtgctcag
caggtctccaaggcgctccatgcgcagggctgccggcaattcttcgtcgcgcatctcgcg
gaggcgatcgaactcagatcgctgctgccgaacgacacgcagatagcggtgctcaacggg
ctgcagcccggagcagagatcacttgcgccaaggccaacattgttccggttctcaactct
ctcgagcaattccggcggtggtcgttcacggctcagaagctcggccgcgttcttcctacc
gttctgcagttcgacaccggcatgtcgcgcctcggcgtaccgctgcaggaaagaactgcg
ctcgccgccgtactcaaggactgcaggagcatcgaaatcctctttatcatgagccatctc
gcctgcgccgacgaggtcgacaacaagcagaatgccgatcagctcgctgagatgcgcctt
atcgccgccgagtttgcagacctcgatgtctgctttgccaattcgggcggcgtctttctg
ggccgcgactatcatggcgccctcagtcgccccggtatcgccctctacggtggcgcgccc
attgccggcagacccaatcccatagagccggtcgtccggctcgacgtcgccgtcatccag
acaaggacggttcccgccgggacgcgtgttggatacggtggtgcgcacgtgacctccgca
gaaaccaggctcgcgacgatcgccgctggctatgccgacggtcttccccgcagtctcagc
gatcgcggcgccgttttcttcgacggcgttcgcctgccgatcgtcggccgtgtctcgatg
gacagcattacggtggacatcaccgccctgcccgagggcacgctttccctcggcagtctt
gtcgaggttctcggcccccatcagacgcttgaggatgtcgccgaagccgccggtacgatc
tcttacgaaattctgaccggcctcggccgccgctacgaacgtcggtaccgctga

DBGET integrated database retrieval system