KEGG   Sinorhizobium fredii USDA 257: USDA257_c07770Help
Entry
USDA257_c07770    CDS       T02188                                 

Gene name
yfcG2
Definition
(GenBank) putative disulfide bond reductase YfcG
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
sfd  Sinorhizobium fredii USDA 257
Brite
KEGG Orthology (KO) [BR:sfd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    USDA257_c07770 (yfcG2)
Enzymes [BR:sfd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     USDA257_c07770 (yfcG2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AFL49370
UniProt: I3X0G4
LinkDB All DBs
Position
822880..823581
Genome map
AA seq 233 aa AA seqDB search
MTAPIELYYWPTPNGWKITIMLEELGVPYAVKYINIGRGDQFAPDFLRISPNNRMPAIID
PDGPGGEPISIFESGAILQYLGRKYGKFYPADERARVEVEQWLYWQVGGLGPMAGQAHHF
RLYAPEEIRYGIDRYTNEVNRLYGVMNKRLIDRPFLAGEYSIADMAAIGWVIPHENQGQD
LNDFPNLKRWFDTMLARPAVQTAIEVGKEERARQKSLAEDEEAQKILFGQRAR
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctcccatcgagctctattactggccgacaccgaacggctggaagatcaccatc
atgctggaggagctcggcgttccctatgcggtcaaatacatcaatatcggccgcggcgac
caattcgcgccggatttcctgaggatatcgccaaacaaccgcatgccggccatcatcgat
ccggacggtccgggcggcgagccgatatcgatcttcgaatccggcgcgatcctgcaatat
ctcggccgcaaatacgggaagttctacccggccgacgagcgcgcccgcgtcgaggtcgag
caatggctctactggcaggttggcggtctgggcccgatggcggggcaggcccatcatttc
cggctctatgcgccggaggagatccgatacggcatcgaccgttacaccaatgaagtgaac
cgcctctatggcgtgatgaacaagcggctcatcgatcggccgttccttgccggcgaatat
tcgatcgccgacatggccgccatcggttgggtgatcccgcacgagaaccagggacaggat
ctcaatgatttcccgaacctgaagcgctggttcgacacgatgctcgcccgaccggcggtc
cagacggcgatcgaggtgggcaaggaagagcgagcccgtcagaagagccttgccgaggac
gaggaagcgcagaaaatcctgttcgggcagcgcgcccgctga

DBGET integrated database retrieval system