KEGG   Sinorhizobium fredii USDA 257: USDA257_c10570Help
Entry
USDA257_c10570    CDS       T02188                                 

Gene name
puuE1
Definition
(GenBank) 4-aminobutyrate aminotransferase PuuE
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd00250  Alanine, aspartate and glutamate metabolism
sfd00410  beta-Alanine metabolism
sfd00640  Propanoate metabolism
sfd00650  Butanoate metabolism
sfd01100  Metabolic pathways
sfd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    USDA257_c10570 (puuE1)
   00650 Butanoate metabolism
    USDA257_c10570 (puuE1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    USDA257_c10570 (puuE1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    USDA257_c10570 (puuE1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sfd01007]
    USDA257_c10570 (puuE1)
Enzymes [BR:sfd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     USDA257_c10570 (puuE1)
Amino acid related enzymes [BR:sfd01007]
 Aminotransferase (transaminase)
  Class III
   USDA257_c10570 (puuE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AFL49648
UniProt: I3X192
LinkDB All DBs
Position
complement(1109406..1110674)
Genome map
AA seq 422 aa AA seqDB search
MTSLTDRKNAAISRGVGMTTQIYADRAENAEIWDKQGNRYIDFAAGIAVVNTGHRHPKVI
AAVKAQLDRFTHTCHQVVPYENYVHLAERLNTLAPGKFAKKTIFVTTGAEAVENAVKIAR
AATGRQAIIAFGGGFHGRTFMGMALTGKVVPYKVGFGSMPADVFHAPFPISLHGVSVEQS
LAALKKLFAADVDPARVAAIILEPVQGEGGFYPAPTAFMKALREICDQHGILLIADEVQT
GFARTGKLFAMEHHDVAPDLTTMAKSLAGGFPLAAVTGRAEIMDAPGPGGLGGTYGGNPI
GIAAAHAVLDVIEEEQLCERANQLGNRLKQRLAAIREKAPEIVDIRGPGFMNAVEFNDTK
TNLPSAEFANKVRLIALEKGLILLTCGVHGNVIRFLAPITIQDEVFAEALDILEASILEA
RG
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcctgaccgaccgcaagaatgccgccatttcccgcggagtgggaatgaccacg
cagatctatgccgaccgcgccgaaaatgccgagatctgggacaagcaaggcaatcgctat
atcgattttgccgccggcatcgccgtcgtcaacaccggccaccgtcacccgaaggtgatc
gccgccgtcaaggcgcagctcgatcgctttacacacacctgccaccaggtcgttccctat
gagaactacgtgcatctggcggagcggctgaatacgctggcacccggcaagttcgcgaag
aagacgatcttcgtcaccaccggcgccgaggcggtcgaaaacgccgtgaagatcgcccgc
gcagcgacgggacggcaggccatcatcgccttcggcggcgggttccatggccgcaccttc
atgggcatggcgctgaccggcaaggtcgtgccctacaaggttggcttcggctcgatgccg
gccgatgtgtttcatgcccccttcccgatctcgctccacggcgtcagtgtcgagcagtcg
ctcgccgcactgaagaagctctttgccgccgatgtcgatccggcccgtgtcgcagcgatc
atcctcgagccggtccagggcgaaggcggtttctatcccgcccccaccgccttcatgaag
gcgctgcgcgaaatctgcgaccagcatggcatcctgttgattgccgacgaagtccagact
ggctttgcccggaccggcaagctcttcgcgatggaacaccacgatgtcgctccggacctg
acgacgatggccaagagccttgccggcggcttcccgctcgccgcagtaacgggccgcgcc
gagatcatggacgcaccgggaccgggcggcctcggcggcacctatggcggcaacccgatc
ggcatcgccgcggcgcacgccgtcctcgacgtgatcgaggaggaacagctttgcgagcgc
gccaaccaactcggcaaccggctgaagcagcgtcttgcagcgatccgcgaaaaggcgccg
gagatcgtcgacattcgcggccccggcttcatgaacgctgtcgagttcaacgacacgaaa
acgaacctgccgagcgccgagttcgccaacaaggtccgcctcattgccctcgaaaaagga
ttgatcctgctcacctgcggtgtccacggcaatgttatccgctttcttgcaccgatcacc
atccaggacgaggtcttcgccgaggctctcgatatcctcgaggcatcgatcctcgaagcg
cgcggttga

DBGET integrated database retrieval system