KEGG   Sinorhizobium fredii USDA 257: USDA257_c11740Help
Entry
USDA257_c11740    CDS       T02188                                 

Gene name
nrtB
Definition
(GenBank) nitrate transport permease protein NrtB
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd00910  Nitrogen metabolism
sfd02010  ABC transporters
Module
sfd_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:sfd00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    USDA257_c11740 (nrtB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    USDA257_c11740 (nrtB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sfd02000]
    USDA257_c11740 (nrtB)
Transporters [BR:sfd02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    USDA257_c11740 (nrtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 Romo1
Motif
Other DBs
NCBI-ProteinID: AFL49765
UniProt: I3X1K9
LinkDB All DBs
Position
1236363..1237256
Genome map
AA seq 297 aa AA seqDB search
MSVTNLKLKPQATPQTSAQVIALGQTASRGIEGRLSRFVTQTVTNLLPLLVTLTFFTLAW
QLICSSPESSLPAPSRVLEESWELIAHPFYIGQGVDQGLFWHVFASLQRVALGYAMAAAV
GVALGTLVGQSALAMRGLDPIFQVLRTVPPLAWLPLSLAAFQDGTPSAIFVIFITAIWPI
IINTAVGIRNIPQDYQNVAKVLRLNGLEYFGKIMLPAAAPYIFTGLRIGIGLSWLAIVAA
EMLIGGVGIGFFIWDAWNSSLISDIIVALIYVGIVGFLLDRLIALIGRAITRGTASA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcaccaatctcaagctcaaaccgcaggcgacgccgcagacttcggctcaggtc
atcgctctcgggcagacggcgagccgcggcatcgaaggccgcctgtcgcgctttgtcacc
cagactgtcaccaacctcttgccgctgctcgtcacactgacgttcttcacccttgcctgg
cagctcatctgctcgtcgcctgaatcgagcctgccggccccgtcgcgcgtcctcgaggaa
agctgggagctgatcgcacatcccttctacatcggtcagggtgtcgatcagggtctgttc
tggcacgtgttcgctagcctgcagcgcgtcgcgctcggctacgccatggctgcggcggtc
ggcgtcgcgcttgggacgctcgtcggccagagcgcgctcgcgatgcgcggcctcgatccg
atcttccaggtgctgcgcaccgtgccgccgctcgcctggctgccgctttcgctcgccgcc
ttccaggacggcaccccttcggcaatcttcgtcatcttcattacggcgatctggccgatc
atcatcaacaccgcggtcggcatccgcaacattccgcaggattaccaaaacgtcgccaag
gtgctgcgactgaacggcctcgaatatttcggcaagatcatgctgccggccgctgccccc
tacatcttcaccggccttaggatcggcatcggtctctcctggctggcgatcgtggcggcc
gagatgctgatcggcggcgtcggcatcggcttcttcatctgggacgcctggaactcgtcg
ctgatcagcgacatcatcgtggcgctgatctatgtcggcatcgtcggcttcctgctcgat
cgcctcatcgcgctgatcggtcgcgccattactcgcggcacagcaagcgcctaa

DBGET integrated database retrieval system