KEGG   Sinorhizobium fredii USDA 257: USDA257_c16580Help
Entry
USDA257_c16580    CDS       T02188                                 

Gene name
ykoU2
Definition
(GenBank) putative ATP-dependent DNA ligase YkoU
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sfd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    USDA257_c16580 (ykoU2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sfd03400]
    USDA257_c16580 (ykoU2)
Enzymes [BR:sfd01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     USDA257_c16580 (ykoU2)
DNA repair and recombination proteins [BR:sfd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     USDA257_c16580 (ykoU2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: AFL50247
UniProt: I3X2Z1
LinkDB All DBs
Position
complement(1757258..1759810)
Genome map
AA seq 850 aa AA seqDB search
MGLDLYREKRDFDSTPEPKGRKARRAGNSFVVQKHDATRLHYDFRLEMDGVLKSWAVTKG
PSLIPGEKRLAVHVEDHPLEYGDFEGTIPKGEYGGGTVILWDRGTWSPIGDARRGYAKGH
LDFELSGEKLGGRWHLVRMAGKPREKRENWLLIKGDDQAARSEEDPDILEERPESVLTGR
EIKDVAGEEPGWSSKTGRIRKRARSKKTTAPQEQEPEAVMNVPDPSKIKGAKAAALPDFV
EPSLATLVSSAPAGERWLHEIKFDGYRLQARIEAGRVRLLTRSGLDWTKRFGKALVSALQ
ALPVGTALIDGEIVVETGSGASDFSGLQADLSEGRSDRFRFYVFDLLYLDGYDLRALPLI
KRKELLDQLIGEDDGIVRFSSHFEEEGRLVLSHACRLSLEGIVSKLRDAPYRTGRNKSWV
KSKCSARQEFVVAGYVPSTTSRKAIGSLVLGVYDGDKLDHVGRVGTGFTAALAEDLLKRL
DRLRTSESPFAARLSAEDARQVRYVKPELVAEVEFRAWTADGHLRHASFRGLREDRLAGE
IVRETPKSTGTQPKPPRRTVKLTHPDRLYWPDEGVTKEGLADYYAEVWRFIGPHIVGRPL
ALVRCPNGITGEQFFQKHAWKGLNPNIVLVNDPKEPPDEQLLSIRDLDGLIALVQSAVLE
IHPWGSTVADWEKPDTIIMDLDPGEDVPFEAVIDAAFETADRLKAAGLVPFVKTSGGKGL
HVVAPLIPKAEWPAVKAFTKSIADAMASDSSDRFVSTITKSKRRGKILVDYLRNQRGATA
VAAYSTRARPGAAVSMPLSWDELAPGIGPAYFTVENTPTRLQSLSADPWADFRAAAIPLK
EPKAGRRKAA
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atgggtctcgatctctaccgagagaagcgcgatttcgactcgacgcccgagccgaagggc
cgcaaggcgcgccgggccggcaacagtttcgttgtccagaagcacgacgcgacacgcctc
cactacgacttccgcctggaaatggacggagttctgaagagctgggccgtcaccaagggg
ccgagcctcattcctggcgagaaacggctggccgttcacgtcgaggatcatcctctcgag
tacggagatttcgaggggacgattccaaagggagaatatggcggcggaaccgtcatcctg
tgggatcgcggcacctggtcgccgatcggcgatgcccgacggggctacgcgaaggggcac
ctcgacttcgaactcagtggtgaaaagctcggcgggcgctggcatctggttcgcatggcc
ggcaagccgcgcgaaaaacgggagaactggctgctgatcaagggtgacgaccaggcggcg
cgatcggaggaagaccccgatattctggaggaacggcccgagtcggtactgaccggccgc
gaaatcaaggacgttgcgggtgaagagcccggctggtcgtcgaagaccggcaggatccgc
aagagggctcgcagcaagaaaacgaccgctcctcaagagcaggagcccgaagccgtcatg
aatgtccctgatccttcaaagatcaagggcgccaaagcggccgccttgccggatttcgtc
gagccttcattggcgacgcttgtttcttccgcaccggccggcgagcgctggcttcacgaa
atcaagttcgacggctataggttgcaggcgcggatcgaagccggccgtgtcaggcttctc
acgcgcagcgggctcgactggaccaagaggttcggcaaggctctggtgtcggcgttgcag
gcgctgcccgtcggaacggcgctgatcgatggtgagatcgtcgtcgaaaccggatccggc
gcgtcggacttctcgggattgcaagctgacttgagcgagggtcgcagcgatcgcttccgc
ttctatgtgttcgaccttctttatctcgatggctacgacctgcgcgccctgccactgatc
aaacggaaggagttgctcgaccaactgatcggcgaagacgacgggatcgtccgcttcagc
agtcattttgaggaggaaggccgcctggtcctcagtcacgcctgcagattgagcctcgaa
ggtatcgtctcaaagctgcgcgatgccccctatcggaccggtcggaacaagagctgggta
aaatccaagtgctcggcgcgtcaggaattcgttgttgccggctacgtgccgtcgaccacg
tcgcgaaaggcgatcggctcactggtgctcggcgtctatgacggcgacaagctcgatcat
gtaggccgtgtgggaacggggttcaccgcggcgcttgcggaggatctcctcaagagactt
gaccgcttgaggacgtcggaaagtccgtttgcggcacgcctaagcgcggaggatgcgcgc
caggtccgatacgtcaagcctgagcttgtggcagaggtcgagttcagagcctggactgct
gacggccatcttcgccacgcctctttcaggggcttgcgtgaggacaggctcgccggcgaa
atcgtccgcgaaacgcccaagtccactggcacgcagcccaagcctccgcgtcggaccgtg
aagctcacccaccctgaccggctctattggccggatgagggggtgacgaaagaggggctt
gccgattattacgccgaggtctggcgctttatcggaccgcatatcgtcggtcgcccgctg
gcattggtcagatgccccaacggaattaccggagagcagttcttccagaagcacgcctgg
aaaggcctgaatcccaacatcgttctggtgaacgacccgaaagaaccacccgacgaacag
ctgttgagcatcagagacctcgatggcctgatcgcgctcgttcagtctgccgttctcgaa
atccatccgtggggatcgaccgtggcggattgggaaaagcccgacacgatcatcatggac
cttgacccgggcgaggacgtgcctttcgaagcggtgatcgacgccgccttcgagacggca
gaccgtctgaaagcggccggccttgtacccttcgtcaagacgtccggcggcaagggactt
cacgtggtggcaccattgatcccaaaggctgaatggccggccgtaaaggccttcacgaag
tcgattgcggacgcgatggcgtccgacagttccgaccgcttcgtctcgacgatcaccaaa
tcgaagcgccgcggaaaaatcctcgtcgactatcttcgcaatcagcgtggagcgacagcg
gtcgcagcatattcgacgcgggcgcgaccgggtgcggccgtgtcgatgccgctctcctgg
gacgaattggcccctggcatcggtccggcgtacttcacggtggagaacacgccgacgcgc
cttcaatccttgagcgccgatccatgggcagattttcgcgcagccgccattccgctcaag
gagccgaaggccgggcgccgaaaggccgcctga

DBGET integrated database retrieval system