KEGG   Sinorhizobium fredii USDA 257: USDA257_c31140Help
Entry
USDA257_c31140    CDS       T02188                                 

Gene name
cbbS
Definition
(GenBank) ribulose bisphosphate carboxylase small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd00630  Glyoxylate and dicarboxylate metabolism
sfd00710  Carbon fixation in photosynthetic organisms
sfd01100  Metabolic pathways
sfd01120  Microbial metabolism in diverse environments
sfd01200  Carbon metabolism
Module
sfd_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:sfd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    USDA257_c31140 (cbbS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    USDA257_c31140 (cbbS)
Enzymes [BR:sfd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     USDA257_c31140 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small ANTAR
Motif
Other DBs
NCBI-ProteinID: AFL51682
UniProt: I3X726
LinkDB All DBs
Position
complement(3263968..3264357)
Genome map
AA seq 129 aa AA seqDB search
MRITQGCFSFLPDLTDEQITAQVEYCLGKGWAIGVEYTDDPHPRNTYWEMWGNPMFDLKD
AKGVMMELEDCRKAHAQDYIRLNAFDSSRGLETVTMSFIVNRPDNEPTLRMTRTESRGRS
QRYAWETQR
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcacccaaggatgcttctcattcctgccggacctgacggatgagcagataacg
gcacaagtggagtattgcctcggcaagggatgggcgatcggcgtcgaatataccgacgac
ccgcacccgcgcaacacctactgggagatgtggggcaatccgatgttcgacctcaaggac
gccaagggcgtgatgatggaattggaggattgccgcaaggctcacgcacaggattacatc
cgcctcaacgccttcgattccagccgcggcttggaaaccgtgacgatgtccttcatcgtc
aaccgtcccgacaacgagccgacactgcggatgacccggacggagagccgcggtcgcagc
caacgctatgcctgggaaacgcagcggtag

DBGET integrated database retrieval system