KEGG   Sinorhizobium fredii USDA 257: USDA257_c31150Help
Entry
USDA257_c31150    CDS       T02188                                 

Gene name
cbbL
Definition
(GenBank) ribulose bisphosphate carboxylase large chain
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd00630  Glyoxylate and dicarboxylate metabolism
sfd00710  Carbon fixation in photosynthetic organisms
sfd01100  Metabolic pathways
sfd01120  Microbial metabolism in diverse environments
sfd01200  Carbon metabolism
Module
sfd_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:sfd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    USDA257_c31150 (cbbL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    USDA257_c31150 (cbbL)
Enzymes [BR:sfd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     USDA257_c31150 (cbbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AFL51683
UniProt: I3X727
LinkDB All DBs
Position
complement(3264384..3265844)
Genome map
AA seq 486 aa AA seqDB search
MNADAKTEIKGKERYRAGVLKYAQMGYWNGDYEPKDTDLIALFRITPQEGVDPIEAAAAV
AGESSTATWTVVWTDRLTACDQYRAKAYRVDPVPGTPGQYFCYVAYDLILFEEGSIANLT
ASIIGNVFSFKPLKAARLEDMRLPVAYVKTFKGPPTGIVVERERLDKFGKPLLGATTKPK
LGLSGKNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRYLYCMDAVNHASAVTGEVKG
HYLNITAGTMEEMYRRAEFAKELGSVIVMVDLIIGWTAIQSISEWCRQNDMILHMHRAGH
GTYTRQKNHGISFRVIAKWLRLAGVDHLHAGTAVGKLEGDPMTVQGYYNVCREMKSVVDL
QRGLFFEQDWADIKKVMPVASGGIHAGQMHQLLDLFGDDVVLQFGGGTIGHPMGIQAGAT
ANRVALEAMVLARNEGRDIANEGPEILRAAAKWCKPLEAALDTWGNISFNYTPTDSSDFV
PSVSVA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgatgcaaagacagaaatcaaaggcaaggaacgctacagggccggggtgctg
aaatacgcgcagatgggctattggaacggcgactacgagccgaaggacaccgatctgatc
gcgctcttccggattaccccgcaggagggggtcgatccgatcgaagcggccgccgccgtg
gccggcgaaagctcgacagccacctggacggtcgtctggaccgatcgcctgacggcctgc
gaccaataccgcgccaaggcctaccgggtcgatccggtccccggaacgcctgggcaatat
ttctgctacgtcgcctacgacctcatcctgttcgaggaaggctcgatcgccaatctgacg
gcgtcgatcatcggcaacgtcttctcgttcaagccgctgaaggcggcacggcttgaggac
atgcgccttcccgtcgcctatgtgaagaccttcaagggcccgccgaccggcatcgtcgtc
gagcgcgaacggctcgacaagttcggcaagccgctgcttggcgccaccaccaagccgaag
ctgggactttccggaaagaactatggtcgggtcgtctacgagggcctgaagggcggcctc
gacttcatgaaggacgacgagaacatcaattcgcagcccttcatgcattggcgcgaccgc
tatctttactgcatggacgccgttaaccacgcctccgccgtcaccggcgaggtcaagggg
cactacctcaacatcaccgccggcacgatggaggaaatgtaccgccgcgccgaattcgcc
aaggagctcggctcggtcatcgtcatggtggatctcatcatcggttggacggcaatccag
tcgatctcggaatggtgccggcagaacgacatgatcctgcacatgcaccgggccggtcac
ggcacctacacgcggcagaagaaccacggcatctccttccgcgtcatcgccaaatggctg
cggcttgccggcgttgaccatctgcatgcgggcaccgccgtcggcaagctcgaaggcgac
ccgatgaccgtgcagggctactacaatgtctgccgcgaaatgaagagcgtcgtcgatctt
cagcgcgggctcttcttcgagcaggactgggccgacatcaagaaagtcatgccggtcgcg
tcgggcggcatccatgccggccagatgcaccaactgctcgatcttttcggcgacgacgtc
gtgctgcagttcggcggcggcacgatcggccatccgatgggcatccaggcaggcgccacc
gccaacagggtggcgctggaggccatggtgctggcccgcaacgaaggccgcgatatcgcc
aatgaaggtcctgaaatcttgagggccgcggccaagtggtgcaagccgctggaagccgcc
ctcgatacctggggcaatatcagcttcaactataccccgacggacagttcggatttcgtg
ccgagcgtaagcgtcgcctga

DBGET integrated database retrieval system