KEGG   Sinorhizobium fredii USDA 257: USDA257_c33880Help
Entry
USDA257_c33880    CDS       T02188                                 

Gene name
tuf2
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
sfd  Sinorhizobium fredii USDA 257
Brite
KEGG Orthology (KO) [BR:sfd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:sfd03012]
    USDA257_c33880 (tuf2)
   03029 Mitochondrial biogenesis [BR:sfd03029]
    USDA257_c33880 (tuf2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sfd04147]
    USDA257_c33880 (tuf2)
Translation factors [BR:sfd03012]
 Eukaryotic Type
  Elongation factors
   USDA257_c33880 (tuf2)
 Prokaryotic Type
   USDA257_c33880 (tuf2)
Mitochondrial biogenesis [BR:sfd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    USDA257_c33880 (tuf2)
Exosome [BR:sfd04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   USDA257_c33880 (tuf2)
  Exosomal proteins of breast cancer cells
   USDA257_c33880 (tuf2)
  Exosomal proteins of colorectal cancer cells
   USDA257_c33880 (tuf2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AFL51948
UniProt: I3X7U2
LinkDB All DBs
Position
3568716..3569891
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEEKARGITIST
AHVEYETPARHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYEFPGDDIPIVKGSALAALEDSDKK
IGEDAIRELMAAVDAYIPTPERPIDLPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEI
EIVGIRPTTKTTCTGVEMFRKLLDQGQAGDNIGALLRGVDRNGVERGQVLCKPGSVKPHR
KFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVTVDVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIVE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagcaaattcgagcgcaacaagccgcacgtcaacatcggcacgattggccac
gttgaccatggcaagacgtcgctgactgcagcgatcaccaagtacttcggcgaattcaag
gcgtatgaccagatcgacgctgcgccggaagagaaggcccgtggcatcaccatttcgacg
gcgcacgtcgaatacgagacgccggcccgccactatgcgcatgtcgactgccccggccac
gccgactacgtcaagaacatgatcaccggtgcggcgcagatggacggcgcgatcctggtg
gtttcggccgccgacggtccgatgccgcagacccgcgagcacatcctgctggctcgccag
gtcggcgttccggcgatcgtcgtgttcctgaacaaggtcgaccaggttgacgacgccgaa
ctgctcgagctcgtcgagctggaagtgcgcgaactgctgtcgtcctacgaattcccgggc
gacgacattccgatcgtcaagggttcggcgctcgccgctctcgaagactccgacaagaag
atcggcgaagacgcgatccgcgagctgatggctgcggttgacgcctacatcccgacgccg
gagcgtccgatcgacctgccgttcctgatgccgatcgaagacgtgttctcgatctccggc
cgcggtacggtcgtcaccggccgcgtcgagcgcggcatcgtcaaggttggtgaggaaatc
gagatcgtcggcatccgtccgacgacgaagacgacctgcacgggcgttgaaatgttccgc
aagctgctcgaccagggccaggccggcgacaacatcggtgcgctcttgcgcggtgtcgac
cgcaacggcgtcgagcgcggtcaggtcctgtgcaagccgggttcggtcaagccgcaccgc
aagttcaaggctgaagcctacatcctgacgaaggaagaaggcggccgtcatacgccgttc
ttcaccaactaccgtccgcagttctacttccgcacgaccgacgtgaccggtatcgtgacg
ctgccggaaggcacggaaatggtaatgccgggcgacaacgtgacggtcgacgtcgaactg
atcgtgccgatcgccatggaagagaagctgcgcttcgctatccgtgaaggcggccgcacc
gtcggcgccggcatcgtcgcctccatcgtcgagtaa

DBGET integrated database retrieval system