KEGG   Sinorhizobium fredii USDA 257: USDA257_c42200Help
Entry
USDA257_c42200    CDS       T02188                                 

Definition
(GenBank) hydroxymyristoyl-acyl carrier protein dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd00061  Fatty acid biosynthesis
sfd00780  Biotin metabolism
sfd01100  Metabolic pathways
sfd01212  Fatty acid metabolism
Module
sfd_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sfd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    USDA257_c42200
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    USDA257_c42200
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sfd01004]
    USDA257_c42200
Enzymes [BR:sfd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     USDA257_c42200
Lipid biosynthesis proteins [BR:sfd01004]
 Fatty acid synthase
  Component type
   USDA257_c42200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA AfsA
Motif
Other DBs
NCBI-ProteinID: AFL52759
UniProt: I3XA53
LinkDB All DBs
Position
complement(4402579..4403055)
Genome map
AA seq 158 aa AA seqDB search
MLLEYFQMVDRVESVDLAAGRLTARSVVPEKSPVFEGHFPGYPLVPGVLLIETMAQASGF
LVLAATKFAAMPFLMSVDGAKMRTFVEPSAELEIEAFLEHEGSGFAVTKAKIASGGKKIC
DAQLKLRTMPFDQVPLGEIVRKRAEEVGLMAATAASEK
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttgaatatttccagatggtcgaccgggtcgaatccgtcgatctcgcggcgggc
cggctcacggcgcgatccgtcgtgccggagaagagcccggtgttcgagggccattttccc
ggctatccgctggttcccggcgtgctactgatcgaaacgatggcacaggcttccggcttt
ctcgtgcttgccgccaccaaattcgcggcgatgcccttcctgatgtcggtcgacggcgcc
aagatgcgcacattcgtcgagccttcggccgagctcgaaatcgaagcatttctcgagcac
gagggctctggcttcgcggtgaccaaggccaagatcgcctcgggcggcaagaagatctgc
gacgcgcagctgaagctcaggacaatgccgttcgatcaggtgccgcttggcgagatcgtc
cgcaagcgcgccgaggaagtgggattgatggccgcgacggccgcttcggagaagtaa

DBGET integrated database retrieval system