KEGG   Sinorhizobium fredii USDA 257: USDA257_c46810Help
Entry
USDA257_c46810    CDS       T02188                                 

Gene name
acoD
Definition
(GenBank) acetaldehyde dehydrogenase 2
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd00010  Glycolysis / Gluconeogenesis
sfd00620  Pyruvate metabolism
sfd01100  Metabolic pathways
sfd01110  Biosynthesis of secondary metabolites
sfd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    USDA257_c46810 (acoD)
   00620 Pyruvate metabolism
    USDA257_c46810 (acoD)
Enzymes [BR:sfd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     USDA257_c46810 (acoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFL53218
UniProt: I3XBG2
LinkDB All DBs
Position
complement(4847497..4849005)
Genome map
AA seq 502 aa AA seqDB search
MLHQKILENPFKHKYGNFIGGEWREPVAGRYFDNTTPVTGGSLCQVARSDAADVELALDA
AHAAKEKWGRTSTTERSNILMKIAARMEDNLELLARAETWDNGKPIRETMAADIPLAIDH
FRYFAACIRAQEGSIGEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAAWKVAPALAAGNC
VVLKPAEQTPASILILAELIADLLPPGVLNIVNGFGLEAGKPLATSPRIAKIAFTGETTT
GRLIMQYASQNLIPVTLELGGKSPNIFFADVLNEDDDYFDKALEGFAMFALNQGEVCTCP
SRALVQESIYDRFMERALKRVEAIRQGNPHDPATMIGAQASGEQLEKILSYIDIGKQEGA
EVLTGGERNVLEGDLSGGYYVKPTVFRGHNKMRIFQEEIFGPVVSVTTFKTEDEALAIAN
DTLYGLGAGMWSRDANRCYRFGREIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMM
LDHYQQTKNMLVSYSPKALGFF
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgctgcatcagaagattctcgagaacccgttcaagcacaagtatggaaatttcatcggc
ggtgagtggcgcgagccggtcgccggccgctatttcgacaataccacgcctgtcaccggc
ggttcgctctgccaggttgcccgttcggatgccgccgatgtcgagctcgcgctcgatgcc
gcccatgccgccaaggagaagtggggccggacctcgacaaccgagcgctccaacatcctg
atgaaaatcgctgcgcggatggaggacaatctcgagcttctggcgcgggccgagacctgg
gacaacggcaagccgatccgcgaaaccatggccgccgacattccgttggcgatcgaccat
ttccgctatttcgccgcctgcattcgggcgcaggaaggctcgatcggcgagatcgaccac
gatacggtcgcctatcatttccatgagccgctcggtgtcgtcggccagatcattccctgg
aatttcccgatcctgatggccgcctggaaggtggcgccggcgcttgcggccggcaactgc
gtcgtcttgaagccggccgagcagacgccggcctcgatcctcatacttgccgaattgatc
gccgacctgttgccgccgggcgtgctcaacatcgtcaacggcttcggcctcgaggcgggc
aagccgctggcgaccagcccgcgcatcgccaagatcgcttttaccggcgagacgacgacg
gggcgactgatcatgcaatatgccagccagaacctcatccccgtgacactcgagctcggc
ggcaagtcgccgaacatcttcttcgccgacgtgctcaacgaggacgacgactatttcgac
aaggcgctggaaggcttcgccatgtttgcgcttaaccagggcgaggtctgcacctgcccg
agccgggcgctggtccaggaaagcatctacgaccgtttcatggagcgggcgctgaagcgg
gtcgaggcgatccgacagggcaatccgcacgacccggcgacgatgatcggcgcccaggcg
tcgggcgaacagctggagaagatcctctcctatatcgacattggcaagcaggagggcgcc
gaggtcctgaccggcggcgagcgcaacgtgctcgagggcgatctctccggtggctattat
gtcaagccaacggtattccgcgggcataacaaaatgcgcatcttccaggaggagatcttc
ggtccggtcgtgtcggtaacaaccttcaagaccgaggacgaggcgctcgcgatcgccaac
gacacgctctacggtctcggagccggcatgtggagccgcgacgccaatcgctgctaccgc
ttcggccgcgagatccaggccggccgcgtctggaccaattgctaccatgcctatccggcg
catgccgccttcggcggttacaagcagtcgggcatcggccgcgagacgcacaagatgatg
ctcgaccactaccagcagaccaagaacatgctggtgagctacagcccgaaggcgctcggc
ttcttctga

DBGET integrated database retrieval system