KEGG   Sinorhizobium fredii USDA 257: USDA257_c47280Help
Entry
USDA257_c47280    CDS       T02188                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase Tdk
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd00240  Pyrimidine metabolism
sfd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    USDA257_c47280 (tdk)
Enzymes [BR:sfd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     USDA257_c47280 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: AFL53264
UniProt: I3XBK8
LinkDB All DBs
Position
complement(4896452..4897039)
Genome map
AA seq 195 aa AA seqDB search
MAKLYFSYATMNAGKSTLLLQASYNYQERGLRVVMLIAAFDDRAGVGYIASRIGLQSEAI
PFLRGDDLYALIDRLNGDGSGKVACVFVDEAQFLGEDQVWQLARIADRLGIPVMAYGLRT
DFQGKLFPGSMALLAIADELREVRTICHCGRKATMVVRLDGAGNVVREGAQVAVGGNEKY
VSYCRRHWEDKMRDD
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagctctatttcagctatgcgacgatgaatgccggcaagagcacgctgctcctg
caggcctcctacaactatcaggagcggggcctgcgcgtcgtgatgctgatcgccgctttc
gacgaccgtgccggggtcgggtacatcgcatcgcgcatcggcttgcagtcggaggcgatt
ccattcctgcggggcgacgatctctacgccctcatcgaccgcctgaacggcgacgggtcc
ggaaaggtcgcctgcgttttcgtcgacgaggcgcaattcctcggcgaggaccaggtctgg
cagcttgcgcgcatcgccgaccgccttgggattccggtcatggcctatggcttgagaacg
gattttcaagggaagctctttccgggctccatggccctgcttgcgattgccgacgaattg
cgcgaggtcaggacgatctgccattgcggacgcaaggcgacgatggtcgtgcgcctcgac
ggcgccggcaatgtcgtgcgcgagggggcgcaggtcgctgtcgggggcaacgagaaatac
gtctcctactgccgccgccattgggaagacaaaatgcgcgacgactga

DBGET integrated database retrieval system