KEGG   Sinorhizobium fredii USDA 257: USDA257_c50190Help
Entry
USDA257_c50190    CDS       T02188                                 

Gene name
ptsP
Definition
(GenBank) phosphoenolpyruvate-protein phosphotransferase PtsP
  KO
K08484  phosphotransferase system, enzyme I, PtsP [EC:2.7.3.9]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:sfd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    USDA257_c50190 (ptsP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sfd02000]
    USDA257_c50190 (ptsP)
Enzymes [BR:sfd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.9  phosphoenolpyruvate---protein phosphotransferase
     USDA257_c50190 (ptsP)
Transporters [BR:sfd02000]
 Phosphotransferase system (PTS)
  Enzyme I and HPr
   Enzyme I [TC:8.A.7]
    USDA257_c50190 (ptsP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP-utilizers_C PEP-utilisers_N PEP-utilizers GAF_2 GAF GAF_3 SpoVT_C
Motif
Other DBs
NCBI-ProteinID: AFL53546
UniProt: I3XCE0
LinkDB All DBs
Position
complement(5212256..5214523)
Genome map
AA seq 755 aa AA seqDB search
MRDLSAGPRVLLKRLRELMAEPLEPQERLDRIVRQIAQNMVAEVCSVYVLRSDGVLELYA
TEGLNKTAVHLAQLKMGQGLVGTIAASARPLNLSDAQAHPAFTYLPETGEEIYHSFLGVP
ILRTGRALGVLVVQNKAMRNYREDEVEALETTAMVLAEMVATGELKKITKPGLELDLSRP
VSIDGNSYGEGIGLGYVVLHEPRIVVTNLLNEDTEHELQRLAEALGSLRISIDDMLSRRD
VSMEGEHRAVLETYRMFAHDRGWVRKLEEAIRNGLTAEAAVERVQSETKARMIRLTDPYL
RERMHDFDDLANRLLRQLSGYGAKLSAADFPNDAIIVARAMGAAELLDYPRENVRGLVLE
EGAVTSHVVIVARAMGIPVVGQAAGAVALAENRDAIIVDGDDAKVHLRPVADLQRSYEEK
VRFRARRQAQFRALKDVEPLTKDGKRITLQMNAGLLVDLPHLNEAGAEGIGLFRTELQFM
IASTMPKAEEQEAFYRNVLKQTGGKPVTFRTLDIGGDKVVPYFRAAEEENPALGWRAIRL
SLDRPGLLRTQFRAMLRAAAGAEFKLMLPMVTEVAELKVARELLQKEIERQSKLGEQLPR
KLQFGAMLEVPALLWQLDELMAEVDFVSVGSNDLFQFAMAVDRGNARVSDRFDILGRPFL
RMLRDIVRAGERNGTPVTLCGEMASKPLSAMALLGIGFRSVSMSPTAVGPVKAMLLALDA
DKLAEVLNAALDDVKSEAPVRQLLVDFAAANGIPV
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgagagacctttccgcgggtccgcgcgttctcctcaagcggttgcgcgagctcatggcg
gaaccgctcgagccgcaggagcgccttgaccggatcgtgcgccagatcgcgcagaacatg
gtcgcggaagtgtgctcggtctacgtgctgcgctccgacggcgtgcttgagctctacgcg
accgaaggtctgaacaagaccgcggtgcacctggcacaactgaagatggggcagggcctc
gtcggcacgatcgccgcctcggcgcgccctctcaatctctccgacgcgcaggcgcatccc
gccttcacctatcttccggagaccggcgaagagatctaccactcgttcctcggcgtgccg
atcctgcgcaccggccgcgcactcggcgttctcgtcgtgcagaacaaggcgatgcgcaac
tatcgcgaggacgaggtcgaggcgctcgagacgaccgccatggtgcttgccgagatggtc
gcgaccggcgagctcaagaagatcaccaagcccggattggaactcgatctatcgcgcccc
gtctcgatcgacggcaacagctatggcgaaggcatcggcctcggctatgtggtgctgcac
gagccgaggatcgtcgttaccaacctgctcaacgaagatacggagcacgaactgcagcgc
ctcgccgaggcgctcgggtcgctgcgcatctcgatcgacgacatgctgtcgaggcgcgac
gtgtcgatggagggcgagcaccgcgccgtgctcgaaacctaccgcatgttcgcccatgac
cgcggctgggtgagaaagctcgaggaagcgatccgcaacggcctgacggcggaggcggcg
gtcgagcgggtgcaaagcgagacgaaggcgcgaatgatccgcctgacggacccttatctc
cgcgagcggatgcacgatttcgacgacctcgccaatcggctgctgcgccagctctccggc
tacggcgccaagttgtcggcggccgacttcccgaacgacgcgatcatcgtggcgcgcgcc
atgggtgccgccgaattgctcgactatccgcgcgagaacgtccgcggcctcgtgctggag
gagggcgccgtcaccagccatgtggtgatcgtcgcacgcgccatgggcattccggtcgtc
ggccaggcggcgggcgccgtggcgcttgccgaaaaccgcgacgcgatcatcgtcgatggc
gacgacgcgaaggtgcatttgcggccggtcgccgacctgcagcggtcctatgaggaaaag
gtgcgcttccgcgcccgccgccaggcgcagttcagggcgctgaaggacgtcgagccgctg
acgaaggacggcaagcgcatcaccctgcagatgaatgccgggcttttggtcgatctgccg
catctcaacgaagcaggcgccgaaggcatcggtctcttccgcaccgagctgcagttcatg
atcgcctcgaccatgccgaaggcggaggaacaggaagccttctaccgcaatgttctgaaa
cagacgggcggcaagccggtgaccttccgcacgctcgacatcggcggcgacaaggtcgtt
ccctatttccgcgcggcagaggaggaaaatccggcgctcggctggcgcgccatccggctt
tcgctcgaccggccgggtctgctgcgtacccagttccgggcgatgctgcgcgcagccgcc
ggcgccgagttcaagctgatgctgccgatggtgacggaggtggcggagctcaaggtcgcg
cgcgagcttttgcagaaggagatcgagcggcagtcgaagctcggcgagcaattgccgcgc
aaactgcagttcggggcgatgctggaggtcccggctctgctctggcagctcgacgagctg
atggccgaggtagatttcgtttcggtcggctcgaatgatctcttccagttcgccatggcg
gtcgatcgtggcaatgcgcgcgtttccgatcgtttcgacattctcggccgtccgttcttg
agaatgctgcgtgacatcgtgcgcgccggcgaacgcaacggcacgccggtgacgctttgc
ggggagatggcgagcaaaccgctttcggccatggcgctgctcgggataggcttccggtcg
gtctccatgtcgccgaccgccgtcggtccggtcaaggccatgctgctcgcgctcgatgcg
gacaagctggccgaagtcctgaacgcggccctggacgacgtaaaatccgaggcgccagtc
cgccagcttctggtcgatttcgcggcggccaacggcataccggtatag

DBGET integrated database retrieval system