KEGG   Sinorhizobium fredii USDA 257: USDA257_c50880Help
Entry
USDA257_c50880    CDS       T02188                                 

Gene name
accA
Definition
(GenBank) acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd00061  Fatty acid biosynthesis
sfd00620  Pyruvate metabolism
sfd00640  Propanoate metabolism
sfd01100  Metabolic pathways
sfd01110  Biosynthesis of secondary metabolites
sfd01120  Microbial metabolism in diverse environments
sfd01130  Biosynthesis of antibiotics
sfd01200  Carbon metabolism
sfd01212  Fatty acid metabolism
Module
sfd_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:sfd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    USDA257_c50880 (accA)
   00640 Propanoate metabolism
    USDA257_c50880 (accA)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    USDA257_c50880 (accA)
Enzymes [BR:sfd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     USDA257_c50880 (accA)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     USDA257_c50880 (accA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACCA Carboxyl_trans MdcE CLP_protease ECH_1
Motif
Other DBs
NCBI-ProteinID: AFL53614
UniProt: I3XCK8
LinkDB All DBs
Position
5275962..5276915
Genome map
AA seq 317 aa AA seqDB search
MHNYLDFEKPISDLEGKILELKKLAGEDESVNTSDEISRLEGRVRDAMAEIYSKLSPWQK
TQVARHPSRPHFLDYAAELFTEFTPLAGDRNFANDDAIQAGLARFRGSPVAVIGQEKGND
TKSRIKHNFGSPRPEGYRKAVRVMEMADRFGLPLITLVDTAGAYPGVNAEERGQAEAIAR
STEMCLNIKVPIVTVVIGEGGSGGAIAIATGNRVFMLEHAIYSVISPEGAASILWRDSTR
AKEAASNMKITAEDLKSLGVIDGIIPEPVGGAHRDPQAVIGRTGTVIADALKELSGRNGD
ELRTDRRQKYLNIGRNL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcacaactatctcgacttcgaaaaacccatctctgatctcgagggcaagatcctcgaa
ttgaagaagcttgccggcgaagacgagagcgtgaacacgtccgacgagatctcgcggctc
gaagggcgcgtgcgcgacgcgatggcggagatctattccaagctgtcgccctggcagaag
acgcaggtcgcgcgccacccgtcccgcccgcatttcctcgactatgccgcggagctcttc
accgagttcacgccgcttgcgggcgaccgcaacttcgccaatgacgatgccatccaggcg
ggtctggcgcggttccgcggctcgccggttgcggtgatcggtcaggagaagggcaacgac
accaaatcgcgcatcaagcacaatttcggcagcccgcgccccgagggctaccgcaaggcg
gtccgcgtgatggagatggccgaccggttcggcctgccgctgatcacgctggtcgatacg
gcaggcgcctatcccggcgttaacgccgaggagcgcggccaagccgaggcgatcgcccgc
tcgaccgaaatgtgcctcaacatcaaggtgccgatcgtcaccgtcgtgatcggcgaaggc
ggctccggcggcgcgatcgcgattgcaaccggcaaccgcgtcttcatgctcgagcatgcg
atctatagcgtcatctcgccggaaggcgcggcctcgatcctatggcgcgattcgacgcgc
gccaaggaagcggccagcaacatgaagatcactgccgaagacctgaaatcgctcggcgta
atcgacggcatcattcccgaaccggtcggcggcgcccaccgcgatccgcaggccgtgatc
ggccgcaccggcaccgtcattgccgacgcgctgaaagagctttccgggcgcaatggcgac
gaattgcggaccgaccgccggcagaagtacctgaatatcggccgcaatctctag

DBGET integrated database retrieval system