KEGG   Sinorhizobium fredii USDA 257: USDA257_c55430Help
Entry
USDA257_c55430    CDS       T02188                                 

Gene name
glpD3
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase GlpD
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sfd  Sinorhizobium fredii USDA 257
Pathway
sfd00564  Glycerophospholipid metabolism
sfd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    USDA257_c55430 (glpD3)
Enzymes [BR:sfd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     USDA257_c55430 (glpD3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 FAD_binding_3 K_oxygenase NAD_binding_8 GIDA
Motif
Other DBs
NCBI-ProteinID: AFL54058
UniProt: I3XDV2
LinkDB All DBs
Position
5756766..5758283
Genome map
AA seq 505 aa AA seqDB search
MSEQAIFDVFVIGGGINGCGIARDAVGRGYSVALAEMDDFASGTSSGSTKLIHGGLRYLE
HYEFRLVREALMEREVLWAMAPHVIWPMRFVLPYHKGGPRPAWLIRLGLFLYDHIGGRKL
LPATGTLDMTRDPAGAPLKRLFTKAFEYSDGWVDDARLVVLNARDAADRGARILARTRVV
SARRENGRWAIETEDAQTGGRETVRARMLVNATGPWVDRVLGDAIGKKDVHNVRLVQGSH
IVVKKQFDDPRAYFFQNPDGRIMFAIPYQGDFTLIGTTDRDFTGNPAEVRISDAEIDYLC
TSASEYFSEPVTRQDIVWTYSAVRPLFDDGASKAQEATRDYVLRLEGQNDQAPLLNVFGG
KLTTYRRLAESALDKIGEAIGAKGNKWTATSHLPGGDFPATGYDAEVERLKARCPFLAAS
HARRLVRLYGTHAAKLLGRAASQTDLGKHFGADLYEVEVDWLIGQEWARRAEDVLWRRTK
LGLKLTPAEIAELEDYMHGAVNAAA
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagagcaggcaatcttcgacgtctttgtcataggcggcggcatcaacggatgcggc
attgcgcgtgatgcggtcggccggggatattccgttgcgctcgccgagatggacgatttc
gcctccggcacctcgtccggctccaccaagctcatccatggcggccttcgctatctcgag
cactacgaattccggttggtgcgcgaagcgctgatggagcgcgaggtgctttgggccatg
gcgccgcacgtcatctggccgatgcgcttcgtcctgccctatcacaagggcggcccgcgc
cctgcctggctgatccgactcggcctattcctttatgatcatatcggcgggcgcaagctg
ttgccggccacgggcacgctggatatgacccgcgatcccgccggcgcgccgctgaagcgc
ctcttcaccaaggccttcgaatattccgacggctgggtcgacgacgcccgtctcgtagtg
ctcaatgcccgcgatgccgccgaccgcggcgcccgcatcttggcgcgcacccgcgtcgtt
tcggcccggcgcgaaaacggtcgctgggcgatcgaaaccgaggacgcccagacgggaggg
cgcgaaacagtccgcgcccgcatgctcgtcaacgccaccggtccctgggtggaccgggtg
ctcggcgacgcgatcggcaagaaggacgtccataatgtccgcctcgtccagggcagccat
atcgtcgtgaagaagcaattcgacgacccgcgcgcctatttcttccagaatccggacggg
cggatcatgttcgccattccttaccaaggcgatttcaccctgatcggcaccaccgaccgg
gattttaccggcaatcccgccgaggtgcgcatcagcgatgccgagatcgactatctctgc
acctcggccagcgaatatttcagcgaaccggtaacccggcaggatattgtctggacctat
tcggcggtgcgcccgctctttgacgacggcgcaagcaaggcgcaggaggcgacccgcgac
tatgtgctgcgcctcgaaggccagaatgaccaggcgccgctgctcaacgtcttcggcggc
aagctcacgacctatcggcggctggccgaatcggcgctcgataagatcggcgaggcgatc
ggcgcaaagggcaacaaatggacggccacgtcgcacctgcctggcggcgactttccggca
accggctacgacgcggaagtcgaaaggctgaaggcgcgctgcccttttctcgctgcttcg
catgcccgccggctggtccggctctacggtacgcatgctgcaaagctgctcggccgtgcc
gcgagccagacggatctcggcaaacacttcggcgcggatctttacgaggtcgaggtcgac
tggctgatcggacaggaatgggcgcggcgtgccgaggacgtgctctggcgccgcacgaaa
ctgggattgaagctgacgccggccgagatcgcggagttggaggactacatgcacggcgcc
gtcaatgccgccgcctga

DBGET integrated database retrieval system