KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_0243Help
Entry
SFxv_0243         CDS       T01883                                 

Gene name
phoA
Definition
(GenBank) Alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
sfe00730  Thiamine metabolism
sfe00790  Folate biosynthesis
sfe01100  Metabolic pathways
sfe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sfe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SFxv_0243 (phoA)
   00790 Folate biosynthesis
    SFxv_0243 (phoA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SFxv_0243 (phoA)
Enzymes [BR:sfe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SFxv_0243 (phoA)
Exosome [BR:sfe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SFxv_0243 (phoA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sfe00537]
 Enzymes
  SFxv_0243 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: ADA72576
UniProt: D2AJ16
LinkDB All DBs
Position
complement(252324..253808)
Genome map
AA seq 494 aa AA seqDB search
MSRPRLIVALFLFFNVFVHGENKVKQSTIALALLPLLFTPVTKARTPEMPVLENRAAQGD
ITAPGGARRLTGDQTAALRDSLSDKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGI
DALPLTGQYTHYALNKKTGKPDYVTDSAASATAWSTDVKTYNGALGVDIHEKDHPTILEM
AKAAGLATGNVSTAELQDATPAALVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQL
LNARADVTLGGGAKTFAETATAGEWQGKTLREQAQARGYQLVNDAASLNSVTEANQQKPL
LGLFADGNMPVRWLGPKATYHGNIDKPAVTYTPNPQRNDSVPTLAQMTDKAIELLSKNEK
GFFLQVEGASIDKQDHAANPCGQIGETVDLDEAVQRALEFAKKEGNTLVIVTADHAHASQ
VVAPDTKAPGLTQALNTKDGAVMVMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQ
TDLFYTMKAALGLK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
ttgtcacggccgagacttatagtcgctttgtttttattttttaatgtatttgtacatgga
gaaaataaagtgaaacaaagcactattgcactggcactcttaccgttactgtttacccct
gtgacaaaagcccggacaccagaaatgcctgttctggaaaaccgggctgctcagggcgat
attactgcacccggcggtgctcgccgcttaacgggtgatcagaccgccgctctgcgtgat
tctcttagcgataaacctgcaaaaaatattattttgctgattggcgatgggatgggggat
tcggaaattactgccgcacgtaattatgccgaaggtgcgggcggcttttttaaaggtatc
gatgccttaccgcttaccgggcaatacactcactatgcgctgaataaaaaaactggcaaa
ccggactacgtcaccgactcggctgcatcagcaaccgcctggtcaaccgatgtcaaaacc
tataacggcgcgctgggcgtcgatattcacgaaaaagatcacccaacgattctggaaatg
gcaaaagccgcaggtctggcgaccggtaacgtttctaccgcagagttgcaggatgccacg
cccgctgcgctggtggcacatgtgacttcgcgcaaatgctacggtccgagcgcgaccagt
gaaaaatgtccgggtaacgctctggaaaaaggcggaaaaggatcgattaccgaacagctg
cttaacgctcgtgccgacgttacgcttggcggcggcgcaaaaacctttgctgaaacggca
accgctggtgaatggcagggaaaaacgctgcgtgaacaggcacaggcgcgtggttatcag
ttggtgaacgatgctgcctcactgaattcggtgacggaagcgaatcagcaaaaacccctg
cttggcctgtttgctgacggcaatatgccagtgcgctggctagggccgaaagcaacgtac
cacggcaatatcgataagcccgcagtcacctatacgcctaatccgcaacgtaatgacagt
gtaccaaccctggcacagatgaccgacaaagccattgaattgttgagtaaaaatgagaaa
ggatttttcctgcaagttgaaggtgcgtcaatcgataaacaggatcacgctgcgaaccct
tgtgggcaaattggcgagacggtcgatctcgatgaagccgtacaacgggcgctggaattc
gctaaaaaggagggtaacacgctggtcatagtcaccgctgatcacgcccacgccagccag
gttgttgcgccggataccaaagcgccgggcctcactcaggcgctaaatactaaagatggc
gcagtgatggtgatgagttacgggaattccgaagaggattcacaagaacataccggcagt
cagttgcgtattgcggcgtatggcccgcatgccgccaatgttgttggactgaccgaccag
accgatctcttctacaccatgaaagccgctctggggctgaaataa

DBGET integrated database retrieval system