KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_0245Help
Entry
SFxv_0245         CDS       T01883                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
sfe00473  D-Alanine metabolism
sfe00550  Peptidoglycan biosynthesis
sfe01100  Metabolic pathways
sfe01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sfe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SFxv_0245 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SFxv_0245 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    SFxv_0245 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sfe01011]
    SFxv_0245 (ddlA)
Enzymes [BR:sfe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SFxv_0245 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:sfe01011]
 Precursor biosynthesis
  Amino acid ligase
   SFxv_0245 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATPgrasp_ST ATP-grasp_4 RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: ADA72578
UniProt: D2AJ18
LinkDB All DBs
Position
254563..255657
Genome map
AA seq 364 aa AA seqDB search
MEKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKSRFDVVLLGIDKQGQWHVSDASNYLLN
ADDPAHIALRPSATSLAQVPGKHEHQLIDAQNGQPLPTVDVIFPIVHGTLGEDGSLQGML
RVANLPFVGSDVLASAACMDKDVTKRLLRDAGLNIAPFITLTRANRHNISFAEVESKLGL
PLFVKPANQGSSVGVSKVTSEEQYAIAVDLAFEFDHKVIVEQGIKGREIECAVLGNDNPQ
ASTCGEIVLTSDFYAYDTKYIDEDGAKVVVPAAIAPEINDKIRAIAVQAYQTLGCAGMAR
VDVFLTPENEVVINEINTLPGFTNISMYPKLWQASGLGYTDLITRLIELALERHAADNAL
KTTM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaactgcgggtaggaatcgtttttggtggtaaatcagcggaacatgaagtgtct
ctgcaatcggcaaaaaacattgtcgatgccattgataaaagtcgcttcgacgttgtgctg
ctgggcattgataaacaagggcaatggcacgtcagcgatgccagcaattatctgctaaat
gcagacgatcctgcccatattgcgttgcgcccttcggcgaccagccttgcgcaggtgcca
ggtaaacatgagcatcagcttatcgacgcgcaaaacggtcagccgttgccgacggtggat
gtcattttcccgattgtccacggtacgctgggcgaagatggttccttgcagggaatgctg
cgggtcgccaatttaccgtttgtaggttctgatgttctggcttcagcagcctgtatggat
aaagatgtcaccaaacgtctgctacgcgatgccgggctgaacattgcgccatttattacc
ctgacgcgcgctaatcgtcacaacatcagttttgccgaagtggagtctaaactggggtta
ccactgtttgtaaaaccggctaatcagggctcttctgttggtgtcagcaaagtaaccagt
gaagaacagtacgcaattgccgtcgatctggcgttcgagttcgatcataaagtgatcgtt
gagcaagggatcaaaggtcgtgagatcgaatgcgcagttctgggcaacgacaatccgcaa
gccagcacctgtggcgagatcgtactcaccagcgatttctatgcctacgacaccaagtac
attgacgaagatggcgcgaaagtggtagttccggcagccattgcaccagagatcaacgat
aagatccgggcgattgccgttcaggcttatcagacgttgggatgcgcaggcatggcgcgt
gtagacgtgtttttaaccccagagaacgaagtggtgatcaacgagatcaacacactgcct
ggcttcaccaacatcagtatgtatccgaagctgtggcaagccagcggtctgggttacacc
gatctgatcacacgtttgattgagctggcgctggagcgtcacgctgcggataacgcattg
aaaaccacaatgtaa

DBGET integrated database retrieval system