KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_1827
Entry
SFxv_1827         CDS       T01883                                 

Gene name
rstB
Definition
(GenBank) putative Sensor protein
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
sfe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sfe00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SFxv_1827 (rstB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sfe01001]
    SFxv_1827 (rstB)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sfe02022]
    SFxv_1827 (rstB)
Enzymes [BR:sfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     SFxv_1827 (rstB)
Protein kinases [BR:sfe01001]
 Histidine kinases
  OmpR family
   SFxv_1827 (rstB)
Two-component system [BR:sfe02022]
 OmpR family
  RstB-RstA
   SFxv_1827 (rstB)
SSDB
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_2 HATPase_c_3
Other DBs
NCBI-ProteinID: ADA74027
UniProt: D2AGA8
LinkDB
Position
1714531..1715832
AA seq 433 aa
MKKLFIQFYLLLFVCFLVMSLLVGLVYKFTAERAGKQSLDDLMNSSLYLMRSELREIPPH
DWGKTLKEMDLNLSFDLRVEPLSKYHLDDISMHRLRGGEIVALDDQYTFLQRIPRSHYVL
AVGPVPYLYYLHQMRLLDIALIAFIAISLAFPVFIWMRPHWQDMLKLEAAAQRFGDGHLN
ERIHFDEGSSFERLGIAFNQMADNINALIASKKQLIDGIAHELRTPLVRLRYRLEMSDNL
SAAESQALNRDISQLEALIEELLTYARLDRPQNELHLSEPDLPLWLSTHLADIQAVTPDK
TVRIKTLMQGHYAALDMRLMERVLDNLLNNALRYCHSTVETSLLLSGNRATLIVEDDGPG
IAPENREHIFEPFVRLDPSRDRSTGGCGLGLAIVHSIALTMGGTVNCDISELGGARFSFS
WPLWHNIPQFTSA
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgaaaaaattgtttatccagttttacctgttattgtttgtctgcttccttgtgatgtct
ctgctggttgggctggtgtacaaatttaccgccgaacgcgcgggcaaacagtcgctggat
gatttgatgaacagttcgctgtatctgatgcgcagcgaattgcgagagatccccccacac
gactggggtaagacgctgaaagagatggatttaaatctctctttcgatctgcgtgtcgag
ccactgagtaaataccatcttgatgatatttccatgcaccgactgcgtggcggcgaaatt
gtcgccctggacgatcagtacacgtttttgcagcgtatcccgcgcagccactacgtgctg
gcagttggtcctgttccttatctttattacctccatcaaatgcgattgctggatatcgcc
ctgatcgcttttattgctatttccctcgcctttccggtgtttatctggatgcgtccgcac
tggcaggatatgttaaaactggaagcagcggcgcaacgatttggcgatgggcatctcaat
gaacgtatccactttgatgagggttcgagctttgaacgacttggtatcgcatttaaccag
atggcggacaatatcaacgccttaattgccagcaaaaaacagcttattgacggtatcgct
cacgaactgcgaacaccgttagtgcgcctgcgttatcgactggagatgagcgataacctg
agcgccgccgaatcccaggcgttgaatcgtgatatcagtcaacttgaagctttaattgaa
gagctgctgacttatgcccgactcgatcgcccacaaaacgagcttcatcttagcgaacca
gacctgccgttgtggctgtcaacgcatctggcagatattcaggcagtaacgcccgataaa
acggtacggataaaaacgctcatgcaaggccattatgcggcgttggatatgcgcttaatg
gagcgcgtgctggataatttgctcaataacgccctgcgctactgccattcaacggttgaa
accagcctgctactgtcggggaatagagcgacattaattgttgaggatgatggcccaggg
attgccccagaaaaccgcgaacatatctttgaaccttttgttcgcctcgatcccagccgg
gatcgctcaaccggcggctgcgggctggggctggcaattgtccactcaatagcactgaca
atgggcggtacggttaattgtgacatcagcgaactgggtggtgctcgcttctcgtttagc
tggccgttatggcataacatcccgcaatttacctctgcctga

DBGET integrated database retrieval system