KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_3256
Entry
SFxv_3256         CDS       T01883                                 

Definition
(GenBank) Toxin subunit Set1B
  KO
K11012  enterotoxin Set1B
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
sfe05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:sfe00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    SFxv_3256
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:sfe02042]
    SFxv_3256
Bacterial toxins [BR:sfe02042]
 Type III toxins: Intracellular toxins
  Others
   Enterotoxin ShET-1
    SFxv_3256
SSDB
Other DBs
NCBI-ProteinID: ADA75301
UniProt: D2A7B8
LinkDB
Position
3109344..3109529
AA seq 61 aa
MVQRNIPFILAPVIHGVRDRGTFLRNDIISCSVIFIHKCPVTSQCDMAVIRLNVTVQRGV
T
NT seq 186 nt   +upstreamnt  +downstreamnt
atggttcagcgtaatattcccttcatactggctcctgtcattcacggtgtccgggacaga
ggtaccttcctccggaatgacataatttcctgttccgtcatttttatccacaaatgccct
gtcacttcccagtgtgatatggctgttatccgacttaatgtcactgttcagcgaggcgtt
acgtga

DBGET integrated database retrieval system