KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_3257
Entry
SFxv_3257         CDS       T01883                                 

Definition
(GenBank) Toxin subunit Set1A
  KO
K11011  enterotoxin Set1A
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
sfe05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:sfe00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    SFxv_3257
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:sfe02042]
    SFxv_3257
Bacterial toxins [BR:sfe02042]
 Type III toxins: Intracellular toxins
  Others
   Enterotoxin ShET-1
    SFxv_3257
SSDB
Motif
Pfam: PHD_2
Other DBs
NCBI-ProteinID: ADA75302
UniProt: D2A7B9
LinkDB
Position
3109533..3110066
AA seq 177 aa
MEVSVFQRQCFHCKLTVFPVFLVQADRCTATDGGMDNRMSLEYQGATVLTQGTFRQVHAT
IKDYLSSPRHLWNGDIHIPGQLTMKDNGLFCPPGQDPIFYCLNCFVFVHANKLPLSRIIQ
AVPPQSVTIAGRFQNIEAGLAVEYHAVQVSWSAGTTKGGYISNRRFTDICILSLKIQ
NT seq 534 nt   +upstreamnt  +downstreamnt
atggaagtcagcgtctttcagcgacagtgttttcattgtaaactgacggttttcccagtc
tttctggttcaggctgaccggtgcactgccactgatggaggcatggataaccggatgtcc
ctggaatatcagggtgccactgtcctgactcagggtaccttccggcaggttcacgctacc
atcaaagattacctttcttccccccggcacctgtggaatggcgacatccatattcccggt
cagctgaccatgaaagataacgggttgttttgcccgcccggccaggatcctatcttttac
tgtctgaactgctttgtttttgttcatgccaacaaactcccactgagccggatcattcag
gctgttcccccacagagtgttaccatagctggcagatttcagaatatagaagcgggtctg
gctgttgagtatcatgctgtacaggtttcctggagtgccggtaccaccaaagggggatat
atttccaatcgtcggttcactgacatttgtatcctgagccttaagatccagtaa

DBGET integrated database retrieval system