KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_4965
Entry
SFxv_4965         CDS       T01883                                 

Gene name
ipaJ
Definition
(GenBank) IpaJ, invasion plasmid antigen
  KO
K23832  cysteine protease IpaJ [EC:3.4.22.-]
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
sfe05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:sfe00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    SFxv_4965 (ipaJ)
Enzymes [BR:sfe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     SFxv_4965 (ipaJ)
SSDB
Other DBs
NCBI-ProteinID: ADA76860
UniProt: D2AJH9
LinkDB
Position
pSFxv_1:102780..103508
AA seq 242 aa
MLYGVLLQGAIPREYMISHQTDVRVNENRVNEQGCFLARKQMYDNSCGAASLLCAAKELG
VDKIPQYKGSMSEMTRKSSLDLDNRCERDLYLITSGNYNPRIHKDNIADAGYSMPDKIVM
ATRLLGLNAYVVEESNIFSQVISFIYPDARDLLIGMGCNIVHQRDVLSSNQRVLEAVAVS
FIGVPVGLHWVLCRPDGSYMDPAVGENYSCFSTMELGARRSNSNFIGYTKIGISIVITNE
AL
NT seq 729 nt   +upstreamnt  +downstreamnt
atgttatatggggttttattgcagggggctataccaagagaatatatgatatctcatcag
actgatgtgagggtaaatgagaatagagtaaacgaacaaggttgttttttggcgaggaag
cagatgtatgacaattcttgtggagctgccagtttactctgtgctgcaaaggaattaggg
gttgataaaataccacaatacaaagggtctatgtccgaaatgacaaggaagagttctctt
gatttggataatcgttgtgagcgggatttatacttaataactagtggtaattataatccg
agaatacacaaagataatatcgcggatgccggttattctatgcctgataagatagtcatg
gctacgaggcttcttggattgaatgcttatgtcgttgaagaaagtaacattttttcgcaa
gtaattagttttatttatcccgatgcaagggacttattaattggcatgggatgtaatata
gtacatcaacgagatgtgttatcttctaaccaaagagttttggaagctgttgctgtatcc
tttattggagttcctgtcggcctccactgggtgttgtgtagacctgatggaagctatatg
gatccagctgtaggagaaaattattcttgtttttcaactatggaattaggtgcaagaaga
agtaattctaactttataggatatactaaaataggtatttccatagttataactaatgag
gctttgtaa

DBGET integrated database retrieval system