KEGG   Shigella flexneri 2002017 (serotype Fxv): SFxv_5131
Entry
SFxv_5131         CDS       T01883                                 

Gene name
icsP
Definition
(GenBank) outer membrane protease
  KO
K13520  outer membrane protease [EC:3.4.23.-]
Organism
sfe  Shigella flexneri 2002017 (serotype Fxv)
Pathway
sfe05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:sfe00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    SFxv_5131 (icsP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sfe01002]
    SFxv_5131 (icsP)
Enzymes [BR:sfe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.-  
     SFxv_5131 (icsP)
Peptidases and inhibitors [BR:sfe01002]
 Aspartic peptidases
  Family A26: omptin family
   SFxv_5131 (icsP)
SSDB
Motif
Pfam: Omptin
Other DBs
NCBI-ProteinID: ADA77026
UniProt: D2AJZ5
LinkDB
Position
pSFxv_1:222013..222993
AA seq 326 aa
MDISTKKVEFSMKLKFFVLALCVPAIFTTHATTNYPLFIPDNISTDISLGSLSGKTKERV
YHPKEGGRKISQLDWKYSNATIVRGGIDWKLIPKVSFGVSGWTTLGNQKASMVDKDWNNS
NTPQVWTDQSWHPNTHLRDANEFELNLKGWLLNNLDYRLGLIAGYQESRYSFNAMGGSYI
YSENGGSRNKKGAHPSGERTIGYKQLFKIPYIGLTANYRHENFEFGAELKYSGWVLSSDT
DKHYQTETIFKDEIKNQNYCSVAANIGYYVTPSAKFYIEGSRNYISNKKGDTSLYEQSTN
ISGTIKNSASIEYIGFLTSAGIKYIF
NT seq 981 nt   +upstreamnt  +downstreamnt
atggacatttcaaccaaaaaagtagagttctcgatgaaattaaaattctttgtacttgca
ctttgtgtacctgcgatctttactacacatgctaccactaactatccacttttcataccg
gacaacatcagtacggatattagtctaggatctctgagtggcaaaacaaaagaacgcgtt
tatcatcccaaggaaggggggagaaaaattagtcaactggactggaaatacagtaatgcg
actattgttagaggtggcatcgattggaagctaattccaaaagtgtctttcggagtttcc
ggttggactactttaggtaaccagaaagcaagcatggttgataaagactggaacaattcc
aatacccctcaggtatggaccgaccagagctggcatcccaatacgcatctccgtgatgct
aacgaattcgagctgaatcttaaaggttggttattaaataatttggattatcgacttgga
ctaatagcaggttaccaagagagtcgttacagttttaatgcaatgggagggagttatatt
tatagtgaaaacggggggagcaggaataaaaaaggggcacatcctagtggtgaaagaaca
ataggttacaaacagctcttcaaaataccttatattggattaactgctaattaccgccat
gagaattttgagtttggagcagaactgaaatatagtggttgggttctttcatctgataca
gataaacactatcagactgagacaatttttaaagatgaaataaaaaaccaaaattactgc
tctgttgctgcgaatattggatactatgtcacccccagtgcaaaattttatatagaaggc
tccagaaattacatttctaataaaaaaggtgatacatctctttatgagcaaagtaccaat
atatctggcaccattaaaaatagtgcaagtattgaatatattggttttctcacttccgca
ggtataaagtatattttttga

DBGET integrated database retrieval system