KEGG   Serratia fonticola GS2: AV650_02645Help
Entry
AV650_02645       CDS       T04716                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sfg  Serratia fonticola GS2
Brite
Enzymes [BR:sfg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AV650_02645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ALX92524
UniProt: A0A0F7H934
LinkDB All DBs
Position
578203..578826
Genome map
AA seq 207 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLEAYPELASLSVEELIQD
LDKVPADKRTFMRNNAGGHANHSLFWKGLKTGTTLGGDLKAAIERDFGSVEKFQEEFEKA
AATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAVSGASGLPIVGLDVWEHAYYLKFQN
RRPDYIKAFWNVVNWDEAAKRFAEAKK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagttattcactgccatccctaccttatgcttacgacgcactagaaccgcatttcgac
aagcagacgatggaaatccatcacaccaaacaccaccagacctacgtcaacaacgccaac
accgtgctggaagcttaccctgagctggcttcgctgagcgtagaagagctgatccaggat
ctggataaagtccctgcagacaagcgcacctttatgcgcaacaacgcaggcggccacgct
aaccacagcctgttctggaaaggcctgaaaaccggcaccacgctgggtggcgatctgaaa
gccgctatcgagcgcgatttcggcagcgtagagaaattccaggaagagttcgagaaagcc
gccgccacccgtttcggttctggctgggcttggctggtgctgaaaggcgacaagctggcc
gtggtgtctaccgctaaccaggacagcccgctgatgggcgaagccgtctccggcgcttca
ggcttgccaatcgttggcctggacgtgtgggaacacgcttactacctgaaattccagaac
cgtcgccctgactacatcaaggcattctggaacgtagtgaactgggacgaagcggccaaa
cgcttcgccgaagccaagaaataa

DBGET integrated database retrieval system