KEGG   Serratia fonticola GS2: AV650_03995Help
Entry
AV650_03995       CDS       T04716                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sfg  Serratia fonticola GS2
Pathway
sfg00620  Pyruvate metabolism
sfg00680  Methane metabolism
sfg01100  Metabolic pathways
sfg01120  Microbial metabolism in diverse environments
sfg01200  Carbon metabolism
Module
sfg_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sfg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AV650_03995
  09102 Energy metabolism
   00680 Methane metabolism
    AV650_03995
Enzymes [BR:sfg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AV650_03995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ALX92772
UniProt: A0A0U3S7Y6
LinkDB All DBs
Position
complement(870047..872683)
Genome map
AA seq 878 aa AA seqDB search
MNEQYSAMRSNVSMLGKLLGDTIKEALGEHILDRVETIRKLSKSSRAGNEAHRQELLSTL
QNLSNDELLPVARAFSQFLNLTNVAEQYHSISPHGEAASNPEALAQLFTKLKDNKLDNKQ
LQKAVDDLSIELVLTAHPTEITRRTLIHKLVEVNTCLSQLDHNDLADYERNKIMRRLRQL
VAQSWHTDEIRKNRPSPVDEAKWGFAVVENSLWEGVPAFLREFNEQLENSIDYRLPVEAV
PIRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKACDLFTRDIQVLVSELSMTECTPELRA
LAGGDEVQEPYRELMKQLRSQLMSSQAYLEGRLKGERVLRPHDLLEHNEQLWEPLYACYQ
SLVACGMSIIANGQLLDTLRRVRCFGVPLVRIDVRQESTRHTEAIAELTRYLGLGDYESW
SEADKQAFLIRELNSKRPLVPLKWEPSADTQEVLETCKVVAEAPQGSIAAYVISMARTPS
DVLAVHLLLKETGCPFALPVAPLFETLDDLNNAEDVMTQLLNIDWYRGFIQGKQMVMIGY
SDSAKDAGVMAASWAQYRAQDALIKTCEKAGVALTLFHGRGGSIGRGGAPAHAALLSQPP
GSLKGGLRVTEQGEMIRFKFGLPEVTISSLALYAGAVLEANLLPPPEPKPEWRTLMDELS
ETSCNMYRGYVRENPEFVPYFRAATPEQELGKLPLGSRPAKRRPNGGVESLRAIPWIFAW
TQNRLMLPAWLGAGAGLQEAVKAGKQDQLEAMCHNWPFFSTRIAMLEMVYAKADLWLAEY
YDQRLVDKSLWPLGQQLRDQLASDIKTVLTIANDDHLMEDLPWIAESIALRNVYTDPLNV
LQAELLHRSRQQEHPDARVEQALMVTIAGVAAGMRNTG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattcggcaatgcgaagtaatgtcagtatgctcggcaaactgctaggc
gataccattaaagaagcgctgggcgagcatattctcgatcgcgttgaaactatccgtaag
ctttccaaatcctcacgtgccggtaacgaggcgcatcgtcaggagctgctctctacgctg
cagaacctgtctaacgatgagctgctgcccgttgcccgcgccttcagccaattcctcaac
ctgaccaacgttgccgagcaataccacagcatctcgccgcacggcgaagcggccagcaac
ccggaagccttggcgcagttgtttaccaagctgaaagacaacaagctggataacaaacag
ctgcaaaaggcggtggacgatctttccatcgagctggtcctgaccgctcacccaacggaa
attacccgccgcaccctgatccacaagctggttgaggtgaacacctgcctgagccaactg
gaccataacgatctggccgactacgagcgtaataaaatcatgcgccgtctgcgccagttg
gtcgcgcaatcctggcataccgacgagatccgcaagaatcgcccatccccggttgatgaa
gccaaatggggctttgccgtggtggaaaacagcctgtgggaaggcgtaccggccttctta
cgcgaattcaacgaacagttggaaaactccatcgattaccgcctgccggtagaagccgtg
cctatccgcttcacctcctggatgggtggcgaccgcgacggcaacccgaacgtgaccgcc
gaaatcacccgtcacgtgctgttgctgagccgctggaaggcctgcgatctgttcacccgt
gatattcaggtgctggtttccgaactgtcgatgaccgaatgtaccccggaactgcgggca
ttggccggtggtgacgaagtacaagaaccttatcgcgaattgatgaagcaactgcgcagc
cagctgatgagctcccaggcctaccttgaaggccgcctgaagggtgaacgcgtgctgcgt
ccgcacgatctgctggaacataacgaacagctgtgggaaccgctgtatgcctgctaccaa
tctttggtggcctgtggcatgagcattatcgccaacggccaactactggacacgctgcgc
cgcgtgcgctgctttggcgtgccgctggtgcgtatcgacgtgcgccaggaaagcacccgc
cataccgaagccattgccgaactgacccgctatctgggcctgggggattatgagagctgg
tcagaagctgacaaacaggcattcctgatccgtgagctgaactccaagcgtccgctggtg
ccactgaagtgggagccgagtgcagacactcaggaagtgctggaaacctgcaaggtagtc
gccgaagcgccacaaggttcgatcgccgcctacgtcatttccatggcacgtaccccgtcc
gacgtcttggccgtgcacctgttgttaaaggagactggttgcccattcgcgctaccggtg
gccccgctgttcgaaaccctcgacgatctgaacaacgccgaagacgtgatgacccagttg
ctgaacatcgactggtatcgcggctttattcagggcaaacagatggtcatgatcggctat
tccgactcggcaaaagatgctggcgtgatggcggcctcctgggcgcaataccgtgcacag
gacgcactgatcaaaacctgtgagaaggccggagtagcactgacgctgttccatggccgt
ggtggttccattggccgtggtggcgcacctgcgcacgccgctctgctgtcccaaccacca
ggcagcctgaaaggtggcctgcgcgtgaccgaacagggcgagatgatccgctttaaattc
ggtctgccagaagtcaccatcagcagcctggcgctgtacgccggtgcggtgttggaagcc
aacctgttgccaccgccggagcctaagccagaatggcgcacgctgatggatgaactgtcc
gaaacctcgtgcaacatgtatcgcggttacgtgcgtgaaaaccctgagtttgtgccttac
ttccgcgccgctacgccagagcaggaactggggaaactgccattgggttcacgcccggcc
aaacgccgcccgaacggcggtgttgaaagcctgcgtgccattccgtggatcttcgcctgg
acgcagaaccgcctgatgctgccagcctggctgggtgccggtgctggcctgcaggaagcg
gtgaaggctggcaagcaggaccagttggaagccatgtgccacaactggccgttcttctct
acccgtatcgcaatgctggagatggtatacgccaaagccgacctgtggctggccgaatac
tacgatcagcgtctggtagacaagtccctgtggccgctcggccaacagttgcgtgatcaa
ttggccagcgatatcaagacggtgctgaccattgccaacgacgaccatctgatggaagac
ctgccgtggatcgctgaatctatcgcgttgcgcaacgtctacaccgacccgctgaacgtg
ttgcaggccgagctgctgcaccgttcgcgccagcaggagcatccggatgcccgcgttgag
caggcgctgatggtcactattgctggcgtggcggccgggatgcgcaacaccggctaa

DBGET integrated database retrieval system