KEGG   Serratia fonticola GS2: AV650_04325
Entry
AV650_04325       CDS       T04716                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
sfg  Serratia fonticola GS2
Pathway
sfg00052  Galactose metabolism
sfg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AV650_04325
Enzymes [BR:sfg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     AV650_04325
SSDB
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C Glu_dehyd_C Methyltransf_31 MTS TrkA_N 2-Hacid_dh_C Methyltransf_25 Shikimate_DH 3HCDH_N PglD_N Sacchrp_dh_NADP ELFV_dehydrog PrmA ThiF Ubie_methyltran
Other DBs
NCBI-ProteinID: ALX92829
UniProt: A0A0U4IPT3
LinkDB
Position
complement(948332..949381)
AA seq 349 aa
MQSVVIHTEGEVRVEERPAPAIEAADEVLVRVAYSGLCGSDIPRIFAKGAHFYPITLGHE
FSGRVVACGDRVTDLQQHDAVACVPLLPCFNCPECQRHYYSLCKHYQFVGSRSHGGNAEF
IVVKRANLVKLPANVSLLQGAFIEPITVGLHAIQLAGGCQGKEVIIIGAGTIGQLAIQCA
RAMGARSVTAIDINDDRLKLARQIGAENAFNSAELSPAQIAERLQERRFDQLILETAGTP
QTVGLALDIAGPRAQIALVGTLHKDLHLSYSTFSQILRKELTLLGSWMNYSAPWPGEEWQ
QAMKLFQSADLALEPLIASIDRPQQYAASVAALAGMPMQGKIMLKLGEE
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgcaatcagtcgtgatccacacggagggagaagtgcgcgttgaagaacgccccgcccct
gctattgaggccgccgatgaggtgttggttcgggtggcttattccgggctatgcggttcg
gatatcccccgcatattcgccaagggagcgcatttctacccgattaccctggggcatgag
ttcagtggccgggtcgtggcctgtggcgatcgggttaccgatctgcaacagcatgatgcc
gtggcctgcgttcctttgttgccatgctttaactgcccggagtgccagcgccattactat
tcgctgtgtaagcattaccagttcgtcggttcacgcagccatggcggcaacgccgagttt
atcgtggtcaaacgcgccaatctggtgaaattgcctgccaacgtcagcttattgcagggg
gcgtttattgagcctatcaccgtcggcctgcatgccattcagttggctgggggttgtcag
ggcaaagaggtgatcatcattggtgccggtaccattggccaattggcgatccagtgcgcc
agagcaatgggcgcacgcagcgtcacggcgatcgatatcaatgacgaccggctcaagctg
gcacgccagatcggcgcagaaaacgcgtttaacagcgcagaactcagtcccgcccagata
gccgaacgcttgcaggaaaggcgttttgatcagttgatcctggaaaccgccggcacgcca
caaacggttggcctggcgctggatatcgccgggccgcgggcacaaatcgcgctggtgggg
actctccataaggatctgcacctgtcttacagcacctttagccagatcctgcgcaaggag
ctaacgctgctgggcagttggatgaactattcggccccgtggccaggggaagagtggcag
caggccatgaagctgttccaatcggcagatttggctctggagccgttgattgccagcatc
gatcgcccgcagcaatacgccgccagcgttgcggccctggccggtatgccgatgcaggga
aaaatcatgcttaagctcggcgaagagtga

DBGET integrated database retrieval system