KEGG   Serratia fonticola GS2: AV650_04560Help
Entry
AV650_04560       CDS       T04716                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sfg  Serratia fonticola GS2
Pathway
sfg00564  Glycerophospholipid metabolism
sfg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AV650_04560 (glpD)
Enzymes [BR:sfg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AV650_04560 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 FAD_binding_2 FAD_oxidored Pyr_redox_2 3HCDH_N Lycopene_cycl GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: ALX92872
UniProt: A0A0U3ZSD3
LinkDB All DBs
Position
complement(1005587..1007095)
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRIGLFLYDHLGKRTSLPGS
KGLRFGPDSVLKPELKRGFEYSDCWVDDARLVVLNAQAVAERGGEVRTRTKVTRAWRENG
LWMVEAIDVDSGKTFTWRAKGLVNATGPWVKHFFDDGLKLKSPYGIRLIKGSHIVVPRAH
NQPQSYILQNEDHRIVFVIPWLDEFSIIGTTDVEYHGDPKDVKIDDNEINYLLKVYNDHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAVTRDYTLDVHDEQGKAPLLSVFGGKLTTYRK
LAEHAMEKLAHYYPGCGPAWTKNGSLPGGNIDGDRDSYAAKLRRQHGWMTESLARRYART
YGSHSEMILANANSLSDLGEDFGHDLYEAELRYLVEKEWVVELDDALWRRTKLGMWLSEE
QQARVKTWLADNAKPKALSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacttgatcgttatcggtggcggtatcaacggagccggcatcgcagcc
gatgcagccgggcgtgggctgtccgtactgctgcttgaagcgcaagacttggcctgtgct
acgtcttccgccagttcaaaactgatccacggtggcctgcgctacctggaacactacgag
tttcgtctggtcagcgaagcgctggccgaacgtgaagtgctgctgaaactggcaccgcac
atcgccttcccaatgcgtttccgcctgccgcaccagccccatctgcgcccggcctggatg
atccgcatcggcctgttcctgtacgatcatttgggcaaacgcaccagcctgccaggcagt
aaaggtttgcgctttggaccagactccgtcctgaagccggaattaaagcgcggtttcgaa
tattctgattgttgggtagacgatgcgcgcctggtcgtgctgaatgcccaagccgtggcc
gaacgcggtggcgaagtgcgcacccgcaccaaagtgacccgcgcctggcgcgaaaatggt
ctgtggatggtggaagccatcgacgtcgacagtggcaaaacctttacctggcgcgccaaa
ggcctggtaaatgccaccggcccatgggtaaaacatttcttcgacgatggcctgaagctc
aagtctccttacggtatccgcctgatcaaaggcagccatatcgtggtacctcgggcacat
aaccagccacagtcttatatcttgcagaacgaagaccaccgtatcgtatttgtcattccg
tggttggatgagttctccatcatcggcaccaccgacgtggaataccacggtgatccgaaa
gacgtgaagatcgacgataacgaaatcaactatctgttgaaggtgtataacgatcacttt
aaaaaacagctgggccgtgacgatatcgtctggacctactctggcgtacgcccgctgtgt
gatgatgaatctgattcaccgcaggccgtcactcgcgactatacgctggatgtgcatgac
gagcagggcaaagccccactgctttccgtgttcggtggcaaactcaccacctaccgcaag
ctggccgagcatgcgatggagaaattggctcactactatcctggctgtggcccggcgtgg
accaaaaacggttccctgccagggggcaatattgacggcgatcgcgatagctatgccgct
aaactgcgccgtcagcacggctggatgacagagtctctggctcgccgttacgctcgcacc
tatggcagccacagcgaaatgatcctggccaatgccaatagcctgagcgatttgggtgaa
gactttggccatgacctgtacgaggctgaactgcgttatctggtagagaaagagtgggtt
gtcgaactggatgatgccctgtggcgccgtaccaaactggggatgtggctcagcgaagag
cagcaagcgcgggtgaaaacctggctggcagacaatgccaaaccaaaagcgttgtcattg
gcgtcttga

DBGET integrated database retrieval system